StarFunc result for job id P27338

User Input

>input (520 residues)
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27338	1.000	1.000	0.000	520	1.000	1.000	P27338.pdb.gz	AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens OX=9606 GN=MAOB PE=1 SV=3
2	AFDB:P19643	0.996	0.996	5.830E-103	520	0.887	0.887	P19643.pdb.gz	AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus OX=10116 GN=Maob PE=1 SV=3
3	AFDB:P58028	0.980	0.980	3.434E-102	520	0.877	0.877	P58028.pdb.gz	AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus OX=10141 GN=MAOB PE=2 SV=2
4	PDB:6fvzA	0.955	0.994	8.149E-101	500	0.960	0.998	6fvzA.pdb.gz	Tight-Binding Inhibition of Human Monoamine Oxidase B by Chromone Analogs: A Kinetic, Crystallographic, and Biological Analysis.
5	AFDB:P21397	0.985	0.972	2.688E-93	527	0.723	0.713	P21397.pdb.gz	AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens OX=9606 GN=MAOA PE=1 SV=1
6	AFDB:P21396	0.982	0.970	2.232E-92	526	0.715	0.707	P21396.pdb.gz	AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus OX=10116 GN=Maoa PE=1 SV=1
7	AFDB:Q6NSN2	0.982	0.979	3.100E-91	522	0.696	0.693	Q6NSN2.pdb.gz	AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio OX=7955 GN=mao PE=1 SV=1
8	PDB:2z5xA	0.981	0.994	1.525E-88	513	0.721	0.731	2z5xA.pdb.gz	Structure of human monoamine oxidase A at 2.2-A resolution: The control of opening the entry for substrates/inhibitors
9	PDB:1o5wC	0.977	0.992	5.929E-83	512	0.719	0.730	1o5wC.pdb.gz	Structure of rat monoamine oxidase a and its specific recognitions for substrates and inhibitors.
10	AFDB:P9WQ15	0.832	0.951	1.892E-53	454	0.315	0.361	P9WQ15.pdb.gz	AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aofH PE=1 SV=1
11	AFDB:H8ZPX1	0.725	0.756	1.299E-31	497	0.198	0.207	H8ZPX1.pdb.gz	PNAO_PSESP Pseudooxynicotine dehydrogenase OS=Pseudomonas sp. OX=306 GN=pao PE=1 SV=1
12	AFDB:Q54HR9	0.731	0.813	2.082E-28	464	0.204	0.228	Q54HR9.pdb.gz	Q54HR9_DICDI Amine oxidase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289265 PE=4 SV=1
13	AFDB:P0CC17	0.715	0.734	4.135E-28	506	0.215	0.221	P0CC17.pdb.gz	OXLA_BOTAT L-amino-acid oxidase OS=Bothrops atrox OX=8725 PE=1 SV=2
14	PDB:5ts5A	0.722	0.774	4.470E-28	483	0.213	0.230	5ts5A.pdb.gz	Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox.
15	PDB:7xe1A	0.629	0.448	3.455E-26	751	0.194	0.134	7xe1A.pdb.gz	Structure-Activity Relationship and In Silico Evaluation of cis- and trans-PCPA-Derived Inhibitors of LSD1 and LSD2
16	PDB:3kpfA	0.669	0.736	7.267E-26	467	0.165	0.184	3kpfA.pdb.gz	The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
17	PDB:5mbxA	0.630	0.689	1.069E-24	472	0.206	0.227	5mbxA.pdb.gz	The Structure of Murine N(1)-Acetylspermine Oxidase Reveals Molecular Details of Vertebrate Polyamine Catabolism.
18	PDB:6tuyA	0.628	0.499	6.476E-22	667	0.185	0.144	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
19	PDB:3nksA	0.637	0.707	1.215E-21	465	0.183	0.204	3nksA.pdb.gz	Structural insight into human variegate porphyria disease
20	PDB:1rsgA	0.634	0.681	1.287E-21	481	0.198	0.214	1rsgA.pdb.gz	Crystal structures of fms1 and its complex with spermine reveal substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19643	0.0	955	520	0.887	0.887	AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus OX=10116 GN=Maob PE=1 SV=3
2	P21396	0.0	775	526	0.698	0.690	AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus OX=10116 GN=Maoa PE=1 SV=1
3	P21397	0.0	808	527	0.723	0.713	AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens OX=9606 GN=MAOA PE=1 SV=1
4	P27338	0.0	1079	520	1.000	1.000	AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens OX=9606 GN=MAOB PE=1 SV=3
5	P58028	0.0	959	520	0.877	0.877	AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus OX=10141 GN=MAOB PE=2 SV=2
6	Q53YE7	0.0	808	527	0.723	0.713	Q53YE7_HUMAN Amine oxidase OS=Homo sapiens OX=9606 GN=MAOA PE=2 SV=1
7	Q64133	0.0	797	526	0.713	0.705	AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus OX=10090 GN=Maoa PE=1 SV=3
8	Q6NSN2	0.0	778	522	0.696	0.693	AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio OX=7955 GN=mao PE=1 SV=1
9	Q8BW75	0.0	980	520	0.887	0.887	AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus OX=10090 GN=Maob PE=1 SV=4
10	P9WQ15	1.72e-78	255	454	0.319	0.366	AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aofH PE=1 SV=1
11	P81383	3.73e-22	101	491	0.256	0.271	OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah OX=8665 PE=1 SV=3
12	Q7X809	1.97e-21	99.4	484	0.225	0.242	PAO3_ORYSJ Polyamine oxidase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAO3 PE=1 SV=2
13	Q7XR46	3.78e-20	95.5	487	0.223	0.238	PAO4_ORYSJ Polyamine oxidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=PAO4 PE=1 SV=1
14	H8ZPX1	1.22e-19	94.0	497	0.221	0.231	PNAO_PSESP Pseudooxynicotine dehydrogenase OS=Pseudomonas sp. OX=306 GN=pao PE=1 SV=1
15	G8XQX1	2.48e-19	93.2	504	0.221	0.228	OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii OX=8707 PE=1 SV=1
16	Q9LYT1	9.31e-19	91.3	488	0.210	0.223	PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana OX=3702 GN=PAO3 PE=1 SV=1
17	P56742	1.79e-18	90.5	516	0.227	0.229	OXLA_CROAT L-amino-acid oxidase apoxin-1 OS=Crotalus atrox OX=8730 PE=1 SV=2
18	Q6TGQ8	5.12e-18	89.4	502	0.223	0.231	OXLA_BOTMO L-amino-acid oxidase BmooLAAO-I OS=Bothrops moojeni OX=98334 PE=1 SV=2
19	P0CC17	5.34e-18	89.0	506	0.223	0.229	OXLA_BOTAT L-amino-acid oxidase OS=Bothrops atrox OX=8725 PE=1 SV=2
20	Q21988	6.72e-18	89.7	824	0.206	0.130	KDM1B_CAEEL Lysine-specific histone demethylase 1B homolog OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	2.6	18.9	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01593 Amino_oxidase	4.9e-69	245.4	Flavin containing amine oxidoreductase
3	PF01266 DAO	0.00031	32.0	FAD dependent oxidoreductase
4	PF00890 FAD_binding_2	0.0087	26.8	FAD binding domain
5	PF01494 FAD_binding_3	0.068	24.0	FAD binding domain
6	PF12831 FAD_oxidored	0.003	28.6	FAD dependent oxidoreductase
7	PF01134 GIDA	5.7	17.5	Glucose inhibited division protein A
8	PF03486 HI0933_like	1.7	18.9	HI0933-like protein
9	PF07991 IlvN	28	15.7	Acetohydroxy acid isomeroreductase, NADPH-binding domain
10	PF05834 Lycopene_cycl	39	14.8	Lycopene cyclase protein
11	PF06100 MCRA	95	13.3	MCRA family
12	PF13450 NAD_binding_8	5e-11	54.0	NAD(P)-binding Rossmann-like domain
13	PF00070 Pyr_redox	0.24	23.2	Pyridine nucleotide-disulphide oxidoreductase
14	PF07992 Pyr_redox_2	0.1	23.4	Pyridine nucleotide-disulphide oxidoreductase
15	PF13738 Pyr_redox_3	5	17.9	Pyridine nucleotide-disulphide oxidoreductase
16	PF01946 Thi4	0.11	23.2	Thi4 family
17	PF02254 TrkA_N	95	14.7	TrkA-N domain
18	PF04820 Trp_halogenase	4.6e+02	11.0	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354511	0.987	Catechol O-methyltransferase
2	9606.ENSP00000403644	0.975	Aromatic-L-amino-acid decarboxylase
3	9606.ENSP00000253799	0.950	Retina-specific copper amine oxidase
4	9606.ENSP00000376776	0.950	Dopamine beta-hydroxylase
5	9606.ENSP00000353820	0.945	Cytochrome P450 2D6
6	9606.ENSP00000280097	0.941	Histamine N-methyltransferase
7	9606.ENSP00000269582	0.939	Phenylethanolamine N-methyltransferase
8	9606.ENSP00000261733	0.936	Aldehyde dehydrogenase, mitochondrial
9	9606.ENSP00000255084	0.932	Aldehyde dehydrogenase family 3 member B2
10	9606.ENSP00000345774	0.931	Fatty aldehyde dehydrogenase
11	9606.ENSP00000363832	0.930	Aldehyde oxidase
12	9606.ENSP00000411821	0.929	Aldehyde dehydrogenase, dimeric NADP-preferring
13	9606.ENSP00000360372	0.928	Cytochrome P450 2C19
14	9606.ENSP00000337915	0.927	Cytochrome P450 3A4
15	9606.ENSP00000473990	0.927	Aldehyde dehydrogenase family 3 member B1
16	9606.ENSP00000361140	0.926	Alcohol dehydrogenase [NADP(+)]
17	9606.ENSP00000250615	0.925	Serotonin N-acetyltransferase
18	9606.ENSP00000366927	0.924	Aldehyde dehydrogenase X, mitochondrial
19	9606.ENSP00000013222	0.919	Indolethylamine N-methyltransferase
20	9606.ENSP00000312326	0.912	Membrane primary amine oxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008131	1.000	primary amine oxidase activity
GO:0005515	0.995	protein binding
GO:0043167	0.891	ion binding
GO:0097159	0.883	organic cyclic compound binding
GO:1901363	0.797	heterocyclic compound binding
GO:0043168	0.644	anion binding
GO:0036094	0.625	small molecule binding
GO:0000166	0.582	nucleotide binding
GO:0050660	0.416	flavin adenine dinucleotide binding
GO:0097621	0.328	monoamine oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:1901615	0.957	organic hydroxy compound metabolic process
GO:0009308	0.957	amine metabolic process
GO:1901360	0.859	organic cyclic compound metabolic process
GO:1901575	0.826	organic substance catabolic process
GO:0044248	0.814	cellular catabolic process
GO:0006725	0.801	cellular aromatic compound metabolic process
GO:0042402	0.755	cellular biogenic amine catabolic process
GO:0065007	0.696	biological regulation
GO:0006576	0.533	biogenic amine metabolic process
GO:0018958	0.494	phenol-containing compound metabolic process
GO:0050789	0.491	regulation of biological process
GO:0050794	0.458	regulation of cellular process
GO:0050896	0.420	response to stimulus
GO:0032501	0.402	multicellular organismal process
GO:0006584	0.387	catecholamine metabolic process
GO:0042417	0.354	dopamine metabolic process
GO:1901361	0.326	organic cyclic compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.996	organelle membrane
GO:0031975	0.985	envelope
GO:0031967	0.973	organelle envelope
GO:0031966	0.879	mitochondrial membrane
GO:0098588	0.705	bounding membrane of organelle
GO:0005829	0.495	cytosol
GO:0005741	0.444	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.3.21	1.000	primary-amine oxidase.
EC:1.4.3.4	0.328	monoamine oxidase.

[back to server]