StarFunc result for job id P27361

User Input

>input (379 residues)
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21708	0.961	0.958	1.053E-65	380	0.971	0.968	P21708.pdb.gz	MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Mapk3 PE=1 SV=5
2	AFDB:Q7ZVK8	0.922	0.892	3.161E-60	392	0.839	0.811	Q7ZVK8.pdb.gz	Q7ZVK8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=wu:fi06b09 PE=1 SV=1
3	AFDB:Q4VH14	0.923	0.947	5.726E-58	369	0.813	0.835	Q4VH14.pdb.gz
4	AFDB:P40417	0.915	0.922	5.806E-57	376	0.757	0.763	P40417.pdb.gz	ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster OX=7227 GN=rl PE=1 SV=3
5	PDB:2zoqA	0.914	0.983	5.300E-56	352	0.929	1.000	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
6	PDB:7opmA	0.895	0.936	4.735E-53	362	0.805	0.843	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
7	AFDB:P39745	0.882	0.754	6.899E-52	444	0.707	0.604	P39745.pdb.gz	MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans OX=6239 GN=mpk-1 PE=1 SV=2
8	PDB:5bvdA	0.845	0.968	2.841E-49	330	0.755	0.867	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
9	AFDB:G4N0Z0	0.856	0.909	1.326E-41	356	0.517	0.551	G4N0Z0.pdb.gz	PMK1_MAGO7 Mitogen-activated protein kinase PMK11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=PMK1 PE=1 SV=1
10	AFDB:O42781	0.844	0.909	4.334E-41	351	0.504	0.544	O42781.pdb.gz	MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii OX=4754 GN=MKP2 PE=1 SV=1
11	AFDB:P27638	0.853	0.868	6.543E-41	372	0.499	0.508	P27638.pdb.gz	SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spk1 PE=1 SV=1
12	AFDB:Q5A1D3	0.848	0.764	2.530E-39	421	0.483	0.435	Q5A1D3.pdb.gz	ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CEK1 PE=1 SV=3
13	AFDB:A9T142	0.860	0.869	6.389E-39	375	0.462	0.467	A9T142.pdb.gz	MPK4A_PHYPA Mitogen-activated protein kinase 4a OS=Physcomitrium patens OX=3218 GN=MPK4a PE=1 SV=1
14	PDB:2b9iA	0.829	0.926	1.861E-35	338	0.462	0.518	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
15	PDB:2lgcA	0.806	0.849	4.141E-33	359	0.438	0.462	2lgcA.pdb.gz
16	PDB:6dtlB	0.812	0.860	7.681E-33	357	0.433	0.459	6dtlB.pdb.gz
17	PDB:3gc8A	0.810	0.880	4.655E-32	347	0.427	0.467	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
18	PDB:2ewaA	0.798	0.911	7.788E-32	330	0.412	0.473	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
19	PDB:7cgaA	0.819	0.890	8.633E-32	347	0.383	0.418	7cgaA.pdb.gz
20	PDB:3coiA	0.780	0.854	6.518E-30	344	0.380	0.419	3coiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4LQZ8	0.0	591	375	0.739	0.747	B4LQZ8_DROVI Mitogen-activated protein kinase OS=Drosophila virilis OX=7244 GN=Dvir\GJ17518 PE=3 SV=1
2	D5GW36	0.0	560	370	0.691	0.708	D5GW36_9BILA mitogen-activated protein kinase (Fragment) OS=Acrobeloides sp. PS-1146 OX=403146 GN=mpk-1 PE=2 SV=1
3	P21708	0.0	762	380	0.971	0.968	MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Mapk3 PE=1 SV=5
4	P26696	0.0	648	361	0.818	0.859	MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis OX=8355 GN=mapk1 PE=1 SV=3
5	P27361	0.0	791	379	1.000	1.000	MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4
6	P28482	0.0	650	360	0.805	0.847	MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3
7	P39745	0.0	555	444	0.694	0.592	MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans OX=6239 GN=mpk-1 PE=1 SV=2
8	P40417	0.0	590	376	0.736	0.742	ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster OX=7227 GN=rl PE=1 SV=3
9	P63085	0.0	650	358	0.802	0.849	MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus OX=10090 GN=Mapk1 PE=1 SV=3
10	P63086	0.0	650	358	0.802	0.849	MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Mapk1 PE=1 SV=3
11	Q63844	0.0	760	380	0.968	0.966	MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapk3 PE=1 SV=5
12	Q7ZVK8	0.0	656	392	0.826	0.798	Q7ZVK8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=wu:fi06b09 PE=1 SV=1
13	Q7ZW72	0.0	646	369	0.813	0.835	Q7ZW72_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=zERK2 PE=1 SV=1
14	G4N0Z0	1.81e-136	395	356	0.520	0.553	PMK1_MAGO7 Mitogen-activated protein kinase PMK11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=PMK1 PE=1 SV=1
15	Q8X1A2	6.40e-136	394	355	0.517	0.552	Q8X1A2_GIBZA Mitogen-activated protein kinase OS=Gibberella zeae OX=5518 GN=pmk1 PE=3 SV=1
16	Q92246	9.20e-136	393	356	0.517	0.551	PMK1_MAGOR Mitogen-activated protein kinase PMK1 OS=Magnaporthe oryzae OX=318829 GN=PMK1 PE=1 SV=2
17	C8V7D1	1.19e-134	390	354	0.522	0.559	C8V7D1_EMENI Mitogen-activated protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mpkB PE=1 SV=1
18	P27638	1.38e-130	380	372	0.485	0.495	SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spk1 PE=1 SV=1
19	P42525	2.45e-130	385	529	0.501	0.359	ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum OX=44689 GN=erkA PE=2 SV=2
20	O42781	3.15e-129	376	351	0.504	0.544	MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii OX=4754 GN=MKP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1	20.0	ABC1 atypical kinase-like domain
2	PF01636 APH	2.9	19.2	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	1.2e+02	13.8	Choline/ethanolamine kinase
4	PF13095 FTA2	1.1e+02	13.9	Kinetochore Sim4 complex subunit FTA2
5	PF12330 Haspin_kinase	29	15.1	Haspin like kinase domain
6	PF06293 Kdo	1.9e+02	12.9	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF00069 Pkinase	1.9e-66	235.8	Protein kinase domain
8	PF17667 Pkinase_fungal	5.6e+02	10.7	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	7.2e-31	119.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302486	0.998	Dual specificity mitogen-activated protein kinase kinase 1
2	9606.ENSP00000376345	0.998	Growth factor receptor-bound protein 2
3	9606.ENSP00000279488	0.997	Dual specificity protein phosphatase 6
4	9606.ENSP00000340944	0.996	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000357055	0.996	Astrocytic phosphoprotein PEA-15
6	9606.ENSP00000262948	0.995	Dual specificity mitogen-activated protein kinase kinase 2
7	9606.ENSP00000403701	0.995	Beta-arrestin-2
8	9606.ENSP00000239223	0.994	Dual specificity protein phosphatase 1
9	9606.ENSP00000360266	0.991	Transcription factor AP-1
10	9606.ENSP00000335153	0.990	Heat shock protein HSP 90-alpha
11	9606.ENSP00000309116	0.989	Tyrosine-protein phosphatase non-receptor type 7
12	9606.ENSP00000368884	0.989	Ribosomal protein S6 kinase alpha-3
13	9606.ENSP00000483056	0.989	ETS domain-containing protein Elk-1
14	9606.ENSP00000215832	0.988	Mitogen-activated protein kinase 1
15	9606.ENSP00000407586	0.987	GTPase HRas
16	9606.ENSP00000427015	0.987	Ribosomal protein S6 kinase alpha-2
17	9606.ENSP00000240100	0.986	Dual specificity protein phosphatase 4
18	9606.ENSP00000251849	0.986	RAF proto-oncogene serine/threonine-protein kinase
19	9606.ENSP00000256078	0.986	GTPase KRas
20	9606.ENSP00000283228	0.986	Receptor-type tyrosine-protein phosphatase R

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004707	1.000	MAP kinase activity
GO:0097159	0.567	organic cyclic compound binding
GO:1901363	0.553	heterocyclic compound binding
GO:0019899	0.433	enzyme binding
GO:0043167	0.306	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.982	response to stimulus
GO:0051716	0.956	cellular response to stimulus
GO:0023052	0.879	signaling
GO:0007154	0.851	cell communication
GO:0008152	0.843	metabolic process
GO:0048518	0.840	positive regulation of biological process
GO:0048522	0.796	positive regulation of cellular process
GO:0007165	0.764	signal transduction
GO:0044237	0.715	cellular metabolic process
GO:0071704	0.683	organic substance metabolic process
GO:0044238	0.673	primary metabolic process
GO:0019222	0.670	regulation of metabolic process
GO:0006807	0.643	nitrogen compound metabolic process
GO:0060255	0.642	regulation of macromolecule metabolic process
GO:0032501	0.633	multicellular organismal process
GO:0032502	0.589	developmental process
GO:0031323	0.588	regulation of cellular metabolic process
GO:0080090	0.587	regulation of primary metabolic process
GO:0051171	0.585	regulation of nitrogen compound metabolic process
GO:0043170	0.584	macromolecule metabolic process
GO:0048856	0.564	anatomical structure development
GO:1901564	0.549	organonitrogen compound metabolic process
GO:0048583	0.496	regulation of response to stimulus
GO:0009966	0.453	regulation of signal transduction
GO:0009893	0.450	positive regulation of metabolic process
GO:0042221	0.430	response to chemical
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0019538	0.419	protein metabolic process
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0031325	0.405	positive regulation of cellular metabolic process
GO:0031326	0.397	regulation of cellular biosynthetic process
GO:0010556	0.393	regulation of macromolecule biosynthetic process
GO:0019219	0.392	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.365	regulation of gene expression
GO:0036211	0.365	protein modification process
GO:0006796	0.358	phosphate-containing compound metabolic process
GO:0048584	0.342	positive regulation of response to stimulus
GO:0048519	0.335	negative regulation of biological process
GO:0035556	0.317	intracellular signal transduction
GO:1902531	0.315	regulation of intracellular signal transduction
GO:0070887	0.310	cellular response to chemical stimulus
GO:0006950	0.308	response to stress
GO:0010033	0.304	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0016020	0.996	membrane
GO:0005829	0.996	cytosol
GO:0071944	0.990	cell periphery
GO:0012505	0.987	endomembrane system
GO:0070013	0.987	intracellular organelle lumen
GO:0005886	0.982	plasma membrane
GO:0005654	0.979	nucleoplasm
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0031982	0.925	vesicle
GO:0031410	0.798	cytoplasmic vesicle
GO:0005856	0.408	cytoskeleton
GO:0005925	0.400	focal adhesion
GO:0005769	0.392	early endosome
GO:0098857	0.366	membrane microdomain
GO:0045121	0.362	membrane raft
GO:0005770	0.351	late endosome
GO:0005901	0.344	caveola
GO:0005576	0.313	extracellular region
GO:0032991	0.312	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	1.000	mitogen-activated protein kinase.

[back to server]