StarFunc result for job id P27448

User Input

>input (753 residues)
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNK
ADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRG
STNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRF
TWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKL
PRLSLNGVRFKRISGTSIAFKNIASKIANELKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27448	1.000	1.000	0.000	753	1.000	1.000	P27448.pdb.gz	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
2	AFDB:Q8VHJ5	0.607	0.576	2.068E-84	795	0.740	0.701	Q8VHJ5.pdb.gz	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2
3	AFDB:Q7KZI7	0.584	0.558	9.997E-79	788	0.671	0.641	Q7KZI7.pdb.gz	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
4	AFDB:E7ETY4	0.568	0.561	1.771E-77	763	0.629	0.621	E7ETY4.pdb.gz	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
5	AFDB:A0A0G2JTD8	0.436	0.477	4.450E-63	688	0.564	0.618	A0A0G2JTD8.pdb.gz	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
6	AFDB:A1ZBL7	0.462	0.355	5.336E-52	993	0.422	0.320	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
7	AFDB:Q14680	0.488	0.558	2.712E-39	651	0.271	0.313	Q14680.pdb.gz	MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK PE=1 SV=3
8	AFDB:F1QGZ6	0.489	0.542	5.323E-38	676	0.264	0.294	F1QGZ6.pdb.gz	MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio OX=7955 GN=melk PE=2 SV=1
9	AFDB:Q8CFH6	0.411	0.335	1.092E-37	931	0.291	0.235	Q8CFH6.pdb.gz	SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1
10	AFDB:A0A0B4J2F2	0.406	0.391	2.022E-37	783	0.307	0.295	A0A0B4J2F2.pdb.gz	SIK1B_HUMAN Putative serine/threonine-protein kinase SIK1B OS=Homo sapiens OX=9606 GN=SIK1B PE=5 SV=1
11	PDB:7myjC	0.347	0.551	2.011E-30	465	0.224	0.363	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:6b1uA	0.350	0.587	6.264E-29	442	0.211	0.360	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:4zhxA	0.344	0.625	1.001E-27	409	0.199	0.367	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:5ufuA	0.345	0.692	5.735E-27	369	0.167	0.341	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:4rerA	0.350	0.563	2.293E-26	459	0.174	0.285	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:4rewA	0.337	0.611	2.414E-26	411	0.170	0.311	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.328	0.529	1.193E-24	459	0.154	0.253	5u6yA.pdb.gz
18	PDB:4d28C	0.322	0.832	5.023E-24	279	0.153	0.412	4d28C.pdb.gz
19	PDB:4cztD	0.320	0.753	1.722E-23	302	0.150	0.374	4cztD.pdb.gz
20	PDB:6byrA	0.328	0.600	6.933E-22	405	0.127	0.237	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD8	838	744	0.567	0.574	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
2	A0A8I6A623	839	688	0.567	0.621	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
3	A1ZBL7	590	993	0.373	0.283	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
4	A1ZBL9	759	1170	0.562	0.362	A1ZBL9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
5	D4A6T9	920	752	0.637	0.638	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
6	E1JGM9	604	827	0.392	0.357	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
7	E1JGN0	583	1141	0.373	0.246	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
8	E7ETY4	932	763	0.672	0.663	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
9	E9PC69	939	778	0.679	0.657	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
10	O08678	1063	793	0.752	0.714	MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus OX=10116 GN=Mark1 PE=1 SV=1
11	O08679	949	722	0.673	0.702	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
12	P27448	1565	753	1.000	1.000	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
13	Q03141	1524	753	0.971	0.971	MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus OX=10090 GN=Mark3 PE=1 SV=2
14	Q05512	930	776	0.672	0.652	MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus OX=10090 GN=Mark2 PE=1 SV=3
15	Q6NPA6	603	833	0.392	0.354	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
16	Q7KZI7	949	788	0.685	0.655	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
17	Q7YU80	595	1046	0.375	0.270	Q7YU80_DROME Par-1, isoform R OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
18	Q86U11	880	431	0.571	0.998	Q86U11_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q8CIP4	920	752	0.639	0.640	MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus OX=10090 GN=Mark4 PE=1 SV=1
20	Q8VHJ5	1062	795	0.746	0.707	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.099	23.3	ABC1 atypical kinase-like domain
2	PF01636 APH	3.5e+02	12.4	Phosphotransferase enzyme family
3	PF02149 KA1	5e-17	72.6	Kinase associated domain 1
4	PF06293 Kdo	28	15.6	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.0042	28.0	Kinase-like
6	PF00069 Pkinase	1e-71	253.0	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	4.8e-41	152.3	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	0.79	20.8	RIO1 family
9	PF00627 UBA	0.018	26.2	UBA/TS-N domain
10	PF08587 UBA_2	25	16.4	Ubiquitin associated domain (UBA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411397

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361930	0.966	14-3-3 protein beta/alpha
2	9606.ENSP00000381958	0.958	Kinase suppressor of Ras 1
3	9606.ENSP00000324804	0.933	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
4	9606.ENSP00000164133	0.918	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
5	9606.ENSP00000221138	0.916	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
6	9606.ENSP00000379287	0.916	14-3-3 protein zeta/delta
7	9606.ENSP00000311344	0.912	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
8	9606.ENSP00000321656	0.911	M-phase inducer phosphatase 3
9	9606.ENSP00000417963	0.910	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
10	9606.ENSP00000412324	0.909	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
11	9606.ENSP00000379098	0.908	Calcium/calmodulin-dependent protein kinase type II subunit beta
12	9606.ENSP00000418447	0.908	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
13	9606.ENSP00000309597	0.907	Mitogen-activated protein kinase kinase kinase 11
14	9606.ENSP00000337641	0.907	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
15	9606.ENSP00000261461	0.906	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
16	9606.ENSP00000319060	0.904	Calcium/calmodulin-dependent protein kinase type II subunit gamma
17	9606.ENSP00000339740	0.904	Calcium/calmodulin-dependent protein kinase type II subunit delta
18	9606.ENSP00000371067	0.904	Tyrosine-protein kinase JAK2
19	9606.ENSP00000381412	0.903	Calcium/calmodulin-dependent protein kinase type II subunit alpha
20	9606.ENSP00000261313	0.901	Phosphatidylethanolamine-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0050321	0.994	tau-protein kinase activity
GO:0097159	0.330	organic cyclic compound binding
GO:1901363	0.312	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0036211	0.991	protein modification process
GO:0006796	0.987	phosphate-containing compound metabolic process
GO:0016310	0.975	phosphorylation
GO:0006468	0.943	protein phosphorylation
GO:0048519	0.838	negative regulation of biological process
GO:0050896	0.760	response to stimulus
GO:0065009	0.688	regulation of molecular function
GO:0048518	0.629	positive regulation of biological process
GO:0010646	0.612	regulation of cell communication
GO:0023051	0.605	regulation of signaling
GO:0019222	0.597	regulation of metabolic process
GO:0048522	0.576	positive regulation of cellular process
GO:0060255	0.563	regulation of macromolecule metabolic process
GO:0018209	0.509	peptidyl-serine modification
GO:0048583	0.504	regulation of response to stimulus
GO:0009966	0.483	regulation of signal transduction
GO:0048523	0.482	negative regulation of cellular process
GO:0051716	0.480	cellular response to stimulus
GO:0080090	0.442	regulation of primary metabolic process
GO:0023052	0.435	signaling
GO:0007154	0.435	cell communication
GO:0007165	0.432	signal transduction
GO:0071840	0.418	cellular component organization or biogenesis
GO:0051171	0.402	regulation of nitrogen compound metabolic process
GO:0016043	0.385	cellular component organization
GO:0031323	0.330	regulation of cellular metabolic process
GO:1902531	0.308	regulation of intracellular signal transduction
GO:0032502	0.302	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0071944	0.994	cell periphery
GO:0043227	0.992	membrane-bounded organelle
GO:0005886	0.979	plasma membrane
GO:0043229	0.972	intracellular organelle
GO:0043228	0.971	non-membrane-bounded organelle
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0005576	0.930	extracellular region
GO:0042995	0.904	cell projection
GO:0031982	0.893	vesicle
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0120025	0.879	plasma membrane bounded cell projection
GO:0005829	0.869	cytosol
GO:0005615	0.846	extracellular space
GO:0043005	0.815	neuron projection
GO:0036477	0.804	somatodendritic compartment
GO:0070062	0.767	extracellular exosome
GO:0097447	0.747	dendritic tree
GO:0005856	0.681	cytoskeleton
GO:0005634	0.536	nucleus
GO:0043233	0.367	organelle lumen
GO:0070013	0.362	intracellular organelle lumen
GO:0031981	0.345	nuclear lumen
GO:0030425	0.341	dendrite
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.26	0.994	[tau protein] kinase.

[back to server]