StarFunc result for job id P27469

User Input

>input (103 residues)
METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQE
AAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:P27469	1.000	1.000	5.252E-14	103	1.000	1.000	P27469.pdb.gz	G0S2_HUMAN G0/G1 switch protein 2 OS=Homo sapiens OX=9606 GN=G0S2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P27469	2.89e-69	204	103	1.000	1.000	G0S2_HUMAN G0/G1 switch protein 2 OS=Homo sapiens OX=9606 GN=G0S2 PE=1 SV=1
2	Q61585	6.70e-50	155	103	0.777	0.777	G0S2_MOUSE G0/G1 switch protein 2 OS=Mus musculus OX=10090 GN=G0s2 PE=1 SV=1
3	Q60759	0.11	33.1	438	0.282	0.066	GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gcdh PE=1 SV=2
4	A0A8I5ZN89	0.14	32.7	438	0.282	0.066	A0A8I5ZN89_RAT Glutaryl-CoA dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gcdh PE=1 SV=1
5	D3ZT90	0.14	32.7	425	0.282	0.068	D3ZT90_RAT Glutaryl-CoA dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gcdh PE=3 SV=2
6	A8JQW3	0.36	31.6	307	0.184	0.062	A8JQW3_DROME Pinin, isoform B OS=Drosophila melanogaster OX=7227 GN=Pnn PE=1 SV=1
7	Q9VH84	0.39	31.6	303	0.184	0.063	Q9VH84_DROME Pinin, isoform A OS=Drosophila melanogaster OX=7227 GN=Pnn PE=1 SV=1
8	Q8IFW3	0.40	31.6	303	0.184	0.063	Q8IFW3_DROME Pinin OS=Drosophila melanogaster OX=7227 GN=Pnn PE=2 SV=1
9	Q38DR9	0.52	31.2	545	0.175	0.033	Q38DR9_TRYB2 4E-interacting protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2380 PE=4 SV=1
10	C8V9N8	1.5	30.0	833	0.262	0.032	C8V9N8_EMENI cysteine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08800 PE=3 SV=1
11	Q92947	1.6	29.6	438	0.282	0.066	GCDH_HUMAN Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GCDH PE=1 SV=1
12	A8MQH3	2.4	29.3	720	0.184	0.026	A8MQH3_ARATH STRUBBELIG-receptor family 6 OS=Arabidopsis thaliana OX=3702 GN=SRF6 PE=1 SV=1
13	Q9FNY0	3.5	28.9	485	0.155	0.033	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
14	Q4GZ26	3.9	28.9	2903	0.175	0.006	Q4GZ26_TRYB2 non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1930 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10337 ArAE_2_N	56	14.2	Putative ER transporter, 6TM, N-terminal
2	PF15030 DUF4527	78	14.1	Protein of unknown function (DUF4527)
3	PF15103 G0-G1_switch_2	2.1e-44	161.5	G0/G1 switch protein 2
4	PF15220 HILPDA	31	16.1	Hypoxia-inducible lipid droplet-associated
5	PF06305 LapA_dom	2e+02	13.2	Lipopolysaccharide assembly protein A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337701	0.951	Patatin-like phospholipase domain-containing protein 2
2	9606.ENSP00000385523	0.940	Peroxisome proliferator-activated receptor alpha
3	9606.ENSP00000417401	0.909	Helicase with zinc finger domain 2
4	9606.ENSP00000419692	0.906	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000399968	0.902	Nuclear receptor coactivator 2
6	9606.ENSP00000405574	0.902	F-box-like/WD repeat-containing protein TBL1XR1
7	9606.ENSP00000217964	0.901	F-box-like/WD repeat-containing protein TBL1X
8	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
9	9606.ENSP00000262188	0.900	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000262367	0.900	CREB-binding protein
11	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
12	9606.ENSP00000325690	0.900	Histone-arginine methyltransferase CARM1
13	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
14	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1
15	9606.ENSP00000457466	0.900	Chromodomain-helicase-DNA-binding protein 9
16	9606.ENSP00000390849	0.774	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
17	9606.ENSP00000318195	0.746	Nucleolin
18	9606.ENSP00000295834	0.705	Fatty acid-binding protein, liver
19	9606.ENSP00000300055	0.633	Perilipin-1
20	9606.ENSP00000244289	0.610	Hormone-sensitive lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0009987	0.993	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0051716	0.966	cellular response to stimulus
GO:0007154	0.918	cell communication
GO:0009966	0.909	regulation of signal transduction
GO:0007165	0.886	signal transduction
GO:2001233	0.858	regulation of apoptotic signaling pathway
GO:0009967	0.851	positive regulation of signal transduction
GO:0097191	0.851	extrinsic apoptotic signaling pathway
GO:0010942	0.817	positive regulation of cell death
GO:2001236	0.767	regulation of extrinsic apoptotic signaling pathway
GO:2001238	0.721	positive regulation of extrinsic apoptotic signaling pathway
GO:0019222	0.587	regulation of metabolic process
GO:0009893	0.491	positive regulation of metabolic process
GO:0060255	0.324	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005739	0.996	mitochondrion
GO:0005811	0.992	lipid droplet
GO:0070013	0.965	intracellular organelle lumen
GO:0031981	0.955	nuclear lumen
GO:0005654	0.810	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]