StarFunc result for job id P27540

User Input

>input (789 residues)
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41739	0.572	0.565	0.000	800	0.914	0.901	P41739.pdb.gz	ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus OX=10116 GN=Arnt PE=1 SV=2
2	AFDB:Q98SN3	0.492	0.482	3.416E-98	805	0.801	0.785	Q98SN3.pdb.gz	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:O15945	0.462	0.563	7.279E-56	642	0.384	0.472	O15945.pdb.gz	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
4	AFDB:F8W2W5	0.178	0.175	3.199E-27	810	0.193	0.188	F8W2W5.pdb.gz	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
5	AFDB:F8VR32	0.150	0.130	1.717E-25	938	0.200	0.168	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
6	AFDB:E1JIM6	0.160	0.129	2.856E-24	1015	0.200	0.156	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
7	AFDB:Q24167	0.158	0.089	3.343E-23	1507	0.185	0.097	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
8	AFDB:Q1ECW2	0.148	0.128	6.778E-20	933	0.155	0.131	Q1ECW2.pdb.gz	NPS4A_DANRE Neuronal PAS domain-containing protein 4A OS=Danio rerio OX=7955 GN=npas4a PE=2 SV=1
9	AFDB:E5L8C8	0.160	0.166	1.463E-13	756	0.160	0.167	E5L8C8.pdb.gz	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
10	AFDB:Q8CEE6	0.118	0.073	5.023E-10	1383	0.147	0.084	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
11	PDB:7rzwB	0.129	0.118	1.944E-4	864	0.035	0.032	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
12	PDB:2wkpA	0.124	0.292	2.929E-4	320	0.020	0.050	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:6umzA	0.114	0.614	3.491E-4	127	0.016	0.102	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
14	PDB:6jp8F	0.096	0.079	7.784E-3	973	0.023	0.018	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
15	PDB:7q3dB	0.066	0.104	8.751E-3	453	0.034	0.060	7q3dB.pdb.gz
16	PDB:7d9tA	0.082	0.119	2.512E-2	512	0.022	0.033	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
17	PDB:6jt0B	0.090	0.119	4.784E-2	576	0.027	0.036	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
18	PDB:7mkuA	0.041	0.084	7.208E-2	302	0.025	0.066	7mkuA.pdb.gz
19	PDB:6wc7G	0.045	0.071	1.295E-1	422	0.022	0.040	6wc7G.pdb.gz
20	PDB:5y58B	0.063	0.085	1.456E-1	568	0.035	0.049	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43392	0.0	684	328	0.414	0.997	O43392_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=2 SV=1
2	P27540	0.0	1637	789	1.000	1.000	ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=1 SV=1
3	P41739	0.0	1476	800	0.914	0.901	ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus OX=10116 GN=Arnt PE=1 SV=2
4	P53762	0.0	1494	791	0.918	0.915	ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator OS=Mus musculus OX=10090 GN=Arnt PE=1 SV=3
5	P79832	0.0	746	723	0.568	0.620	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
6	Q1JPT1	0.0	684	440	0.420	0.752	Q1JPT1_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
7	Q61324	0.0	834	712	0.592	0.656	ARNT2_MOUSE Aryl hydrocarbon receptor nuclear translocator 2 OS=Mus musculus OX=10090 GN=Arnt2 PE=1 SV=2
8	Q64FF8	0.0	589	404	0.366	0.715	Q64FF8_DANRE Aryl hydrocarbon receptor nuclear translocator isoform b OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
9	Q64FF9	0.0	686	503	0.421	0.660	Q64FF9_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
10	Q78E60	0.0	839	712	0.596	0.660	ARNT2_RAT Aryl hydrocarbon receptor nuclear translocator 2 OS=Rattus norvegicus OX=10116 GN=Arnt2 PE=2 SV=1
11	Q98SN3	0.0	1258	805	0.800	0.784	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q9BE97	0.0	1556	790	0.958	0.957	ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=1 SV=1
13	Q9DG12	0.0	827	737	0.589	0.631	ARNT2_DANRE Aryl hydrocarbon receptor nuclear translocator 2 OS=Danio rerio OX=7955 GN=arnt2 PE=1 SV=2
14	Q9HBZ2	0.0	861	717	0.589	0.649	ARNT2_HUMAN Aryl hydrocarbon receptor nuclear translocator 2 OS=Homo sapiens OX=9606 GN=ARNT2 PE=1 SV=2
15	X5DQN9	0.0	861	717	0.589	0.649	X5DQN9_HUMAN Aryl-hydrocarbon receptor nuclear translocator 2 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=ARNT2 PE=2 SV=1
16	O15945	3.05e-174	517	642	0.318	0.391	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
17	Q9I879	1.80e-114	362	626	0.234	0.296	Q9I879_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1a OS=Danio rerio OX=7955 GN=bmal1a PE=1 SV=1
18	O02219	7.01e-114	355	453	0.242	0.422	AHA1_CAEEL Aryl hydrocarbon receptor nuclear translocator homolog OS=Caenorhabditis elegans OX=6239 GN=aha-1 PE=1 SV=1
19	Q8JIG1	4.94e-113	358	622	0.228	0.289	Q8JIG1_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1b OS=Danio rerio OX=7955 GN=bmal1b PE=2 SV=1
20	Q9I8T7	1.11e-108	347	633	0.226	0.281	BMAL1_CHICK Basic helix-loop-helix ARNT-like protein 1 OS=Gallus gallus OX=9031 GN=BMAL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	6.8e-11	53.3	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	8.7e-20	82.2	PAS fold
3	PF14598 PAS_11	1.8e-20	84.5	PAS domain
4	PF08447 PAS_3	6.2e-21	85.8	PAS fold
5	PF08448 PAS_4	6.3	18.5	PAS fold
6	PF13426 PAS_9	7e-06	37.6	PAS domain
7	PF15798 PRAS	55	15.7	Proline-rich AKT1 substrate 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263734	0.999	Endothelial PAS domain-containing protein 1
2	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
3	9606.ENSP00000242057	0.998	Aryl hydrocarbon receptor
4	9606.ENSP00000263253	0.998	Histone acetyltransferase p300
5	9606.ENSP00000369050	0.989	Cytochrome P450 1A1
6	9606.ENSP00000478570	0.985	Vascular endothelial growth factor A
7	9606.ENSP00000366898	0.982	Hypoxia-inducible factor 3-alpha
8	9606.ENSP00000445175	0.980	Lactate dehydrogenase A
9	9606.ENSP00000451828	0.979	RAC-alpha serine/threonine-protein kinase
10	9606.ENSP00000355330	0.977	Protein-glutamine gamma-glutamyltransferase 2
11	9606.ENSP00000289371	0.976	Eukaryotic translation initiation factor 5B
12	9606.ENSP00000262367	0.974	CREB-binding protein
13	9606.ENSP00000252723	0.970	Erythropoietin
14	9606.ENSP00000290399	0.966	Single-minded homolog 2
15	9606.ENSP00000367608	0.964	Carbonic anhydrase 9
16	9606.ENSP00000256474	0.962	Von Hippel-Lindau disease tumor suppressor
17	9606.ENSP00000348460	0.957	Neuronal PAS domain-containing protein 3
18	9606.ENSP00000357348	0.954	Hairy/enhancer-of-split related with YRPW motif protein 2
19	9606.ENSP00000360266	0.951	Transcription factor AP-1
20	9606.ENSP00000385216	0.948	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.999	sequence-specific DNA binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0046982	0.996	protein heterodimerization activity
GO:0003690	0.987	double-stranded DNA binding
GO:1990837	0.984	sequence-specific double-stranded DNA binding
GO:0008134	0.983	transcription factor binding
GO:0001067	0.965	transcription regulatory region nucleic acid binding
GO:0000976	0.959	transcription cis-regulatory region binding
GO:0140297	0.921	DNA-binding transcription factor binding
GO:0000981	0.911	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005102	0.638	signaling receptor binding
GO:0061629	0.625	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0098531	0.398	ligand-activated transcription factor activity
GO:0044877	0.365	protein-containing complex binding
GO:0001046	0.325	core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0031323	0.996	regulation of cellular metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0048522	0.980	positive regulation of cellular process
GO:0010468	0.979	regulation of gene expression
GO:0009893	0.970	positive regulation of metabolic process
GO:0042221	0.966	response to chemical
GO:0031326	0.955	regulation of cellular biosynthetic process
GO:0010556	0.954	regulation of macromolecule biosynthetic process
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.938	regulation of DNA-templated transcription
GO:0001666	0.921	response to hypoxia
GO:0010604	0.921	positive regulation of macromolecule metabolic process
GO:0031325	0.913	positive regulation of cellular metabolic process
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0009987	0.770	cellular process
GO:0031328	0.704	positive regulation of cellular biosynthetic process
GO:0045935	0.689	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.684	positive regulation of nucleic acid-templated transcription
GO:0045893	0.667	positive regulation of DNA-templated transcription
GO:0051716	0.450	cellular response to stimulus
GO:0010646	0.398	regulation of cell communication
GO:0048583	0.385	regulation of response to stimulus
GO:0023051	0.376	regulation of signaling
GO:0048519	0.374	negative regulation of biological process
GO:0048523	0.352	negative regulation of cellular process
GO:0009966	0.351	regulation of signal transduction
GO:0010033	0.315	response to organic substance
GO:0006357	0.309	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.993	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0005737	0.868	cytoplasm
GO:0005667	0.657	transcription regulator complex
GO:0005829	0.476	cytosol
GO:0140513	0.434	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]