StarFunc result for job id P27695

User Input

>input (318 residues)
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27695	1.000	1.000	4.297E-70	318	1.000	1.000	P27695.pdb.gz	APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2
2	PDB:7cd5A	0.872	0.997	2.082E-59	278	0.852	0.975	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
3	AFDB:A0MTA1	0.906	0.929	5.758E-55	310	0.664	0.681	A0MTA1.pdb.gz	APEX1_DANRE DNA-(apurinic or apyrimidinic site) endonuclease OS=Danio rerio OX=7955 GN=apex1 PE=1 SV=1
4	PDB:2o3cB	0.861	0.976	1.009E-48	280	0.616	0.700	2o3cB.pdb.gz
5	AFDB:P27864	0.801	0.379	2.701E-42	679	0.497	0.233	P27864.pdb.gz	RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster OX=7227 GN=Rrp1 PE=1 SV=2
6	AFDB:G3V5Q1	0.637	0.834	1.157E-38	242	0.761	1.000	G3V5Q1.pdb.gz	G3V5Q1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=1
7	AFDB:P45951	0.777	0.467	3.665E-35	536	0.428	0.254	P45951.pdb.gz	ARP_ARATH DNA-(apurinic or apyrimidinic site) endonuclease, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARP PE=1 SV=2
8	AFDB:P51173	0.782	0.690	1.221E-34	361	0.374	0.330	P51173.pdb.gz	APEA_DICDI DNA-(apurinic or apyrimidinic site) endonuclease OS=Dictyostelium discoideum OX=44689 GN=apeA PE=2 SV=2
9	AFDB:G5EBR7	0.773	0.852	1.975E-34	288	0.365	0.403	G5EBR7.pdb.gz	G5EBR7_CAEEL DNA-(apurinic or apyrimidinic site) endonuclease OS=Caenorhabditis elegans OX=6239 GN=exo-3 PE=1 SV=1
10	AFDB:Q57X31	0.756	0.614	2.237E-27	396	0.340	0.273	Q57X31.pdb.gz	Q57X31_TRYB2 DNA-(apurinic or apyrimidinic site) endonuclease OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.110 PE=3 SV=1
11	AFDB:O15922	0.746	0.539	1.951E-26	447	0.327	0.233	O15922.pdb.gz	O15922_LEIMA DNA-(apurinic or apyrimidinic site) endonuclease OS=Leishmania major OX=5664 GN=LmAP PE=1 SV=1
12	PDB:2j63A	0.753	0.721	2.258E-24	333	0.305	0.291	2j63A.pdb.gz
13	AFDB:G3XDB0	0.748	0.911	7.090E-24	259	0.223	0.274	G3XDB0.pdb.gz	G3XDB0_PSEAE Catabolite repression control protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=crc PE=3 SV=1
14	PDB:6o1kA	0.732	0.881	5.477E-23	262	0.226	0.275	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
15	PDB:1akoA	0.710	0.835	3.032E-20	268	0.220	0.261	1akoA.pdb.gz
16	PDB:4f1iA	0.507	0.493	1.362E-8	328	0.157	0.152	4f1iA.pdb.gz
17	PDB:7kiuA	0.525	0.618	2.803E-8	263	0.119	0.144	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
18	PDB:7ax1A	0.489	0.327	4.022E-8	518	0.182	0.112	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
19	PDB:4awnA	0.523	0.620	3.302E-7	260	0.145	0.177	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
20	PDB:2a3zB	0.518	0.614	2.007E-6	260	0.148	0.181	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V3M6	0.0	540	263	0.827	1.000	G3V3M6_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=1
2	P27695	0.0	656	318	1.000	1.000	APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2
3	P28352	0.0	617	317	0.943	0.946	APEX1_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease OS=Mus musculus OX=10090 GN=Apex1 PE=1 SV=2
4	P43138	0.0	615	317	0.934	0.937	APEX1_RAT DNA-(apurinic or apyrimidinic site) endonuclease OS=Rattus norvegicus OX=10116 GN=Apex1 PE=1 SV=2
5	Q5TZP7	0.0	656	318	1.000	1.000	Q5TZP7_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=2 SV=1
6	G3V5Q1	2.56e-174	484	242	0.761	1.000	G3V5Q1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=1
7	A0MTA1	1.61e-151	429	310	0.664	0.681	APEX1_DANRE DNA-(apurinic or apyrimidinic site) endonuclease OS=Danio rerio OX=7955 GN=apex1 PE=1 SV=1
8	P27864	9.57e-102	314	679	0.456	0.214	RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster OX=7227 GN=Rrp1 PE=1 SV=2
9	P51173	8.55e-81	251	361	0.384	0.338	APEA_DICDI DNA-(apurinic or apyrimidinic site) endonuclease OS=Dictyostelium discoideum OX=44689 GN=apeA PE=2 SV=2
10	P45951	4.28e-76	244	536	0.428	0.254	ARP_ARATH DNA-(apurinic or apyrimidinic site) endonuclease, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARP PE=1 SV=2
11	G5EBR7	1.51e-72	227	288	0.365	0.403	G5EBR7_CAEEL DNA-(apurinic or apyrimidinic site) endonuclease OS=Caenorhabditis elegans OX=6239 GN=exo-3 PE=1 SV=1
12	Q57X31	1.21e-39	145	396	0.333	0.268	Q57X31_TRYB2 DNA-(apurinic or apyrimidinic site) endonuclease OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.110 PE=3 SV=1
13	O15922	2.24e-36	137	447	0.374	0.266	O15922_LEIMA DNA-(apurinic or apyrimidinic site) endonuclease OS=Leishmania major OX=5664 GN=LmAP PE=1 SV=1
14	Q564V5	1.89e-31	118	186	0.201	0.344	Q564V5_CAEEL DNA-(apurinic or apyrimidinic site) endonuclease OS=Caenorhabditis elegans OX=6239 GN=exo-3 PE=1 SV=1
15	G3XDB0	2.30e-27	109	259	0.230	0.282	G3XDB0_PSEAE Catabolite repression control protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=crc PE=3 SV=1
16	Q51380	2.30e-27	109	259	0.230	0.282	Q51380_PSEAI Catabolite repression control protein OS=Pseudomonas aeruginosa OX=287 GN=crc PE=1 SV=1
17	P87175	7.88e-27	112	523	0.277	0.168	APN2_SCHPO DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apn2 PE=1 SV=1
18	O97240	1.22e-24	106	617	0.299	0.154	APEX_PLAF7 DNA-(apurinic or apyrimidinic site) endonuclease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=APE1 PE=1 SV=2
19	P09030	1.03e-23	100	268	0.226	0.269	EX3_ECOLI Exodeoxyribonuclease III OS=Escherichia coli (strain K12) OX=83333 GN=xthA PE=1 SV=4
20	E5KN95	1.26e-18	88.6	518	0.274	0.168	E5KN95_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	2.1e-18	78.4	Endonuclease/Exonuclease/phosphatase family
2	PF14529 Exo_endo_phos_2	19	16.6	Endonuclease-reverse transcriptase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216714

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262887	0.996	DNA repair protein XRCC1
2	9606.ENSP00000265421	0.996	DNA polymerase beta
3	9606.ENSP00000337060	0.996	Nucleoside diphosphate kinase A
4	9606.ENSP00000219066	0.995	Endonuclease III-like protein 1
5	9606.ENSP00000361170	0.995	Adenine DNA glycosylase
6	9606.ENSP00000296930	0.992	Nucleophosmin
7	9606.ENSP00000305480	0.992	Flap endonuclease 1
8	9606.ENSP00000363641	0.991	Thioredoxin
9	9606.ENSP00000417864	0.991	Acidic leucine-rich nuclear phosphoprotein 32 family member A
10	9606.ENSP00000242576	0.989	Uracil-DNA glycosylase
11	9606.ENSP00000274306	0.987	Granzyme A
12	9606.ENSP00000306561	0.987	N-glycosylase/DNA lyase
13	9606.ENSP00000361626	0.987	Nuclease-sensitive element-binding protein 1
14	9606.ENSP00000361777	0.987	Protein SET
15	9606.ENSP00000269305	0.985	Cellular tumor antigen p53
16	9606.ENSP00000263274	0.974	DNA ligase 1
17	9606.ENSP00000263253	0.973	Histone acetyltransferase p300
18	9606.ENSP00000437955	0.969	Hypoxia-inducible factor 1-alpha
19	9606.ENSP00000295767	0.957	Mitochondrial intermembrane space import and assembly protein 40
20	9606.ENSP00000296503	0.955	High mobility group protein B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003906	0.999	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004536	0.999	deoxyribonuclease activity
GO:0004521	0.999	RNA endonuclease activity
GO:0008408	0.998	3'-5' exonuclease activity
GO:0008081	0.995	phosphoric diester hydrolase activity
GO:0003676	0.988	nucleic acid binding
GO:0016888	0.986	endodeoxyribonuclease activity, producing 5'-phosphomonoesters
GO:0016895	0.975	DNA exonuclease activity, producing 5'-phosphomonoesters
GO:0003677	0.974	DNA binding
GO:0008296	0.972	3'-5'-DNA exonuclease activity
GO:0003723	0.869	RNA binding
GO:0003690	0.844	double-stranded DNA binding
GO:0003684	0.840	damaged DNA binding
GO:0043167	0.836	ion binding
GO:0043565	0.832	sequence-specific DNA binding
GO:0140110	0.823	transcription regulator activity
GO:0061629	0.817	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003682	0.814	chromatin binding
GO:0003712	0.813	transcription coregulator activity
GO:0004523	0.812	RNA-DNA hybrid ribonuclease activity
GO:0043169	0.808	cation binding
GO:0004844	0.806	uracil DNA N-glycosylase activity
GO:0044877	0.802	protein-containing complex binding
GO:0003691	0.802	double-stranded telomeric DNA binding
GO:0031490	0.791	chromatin DNA binding
GO:0046872	0.790	metal ion binding
GO:0003714	0.787	transcription corepressor activity
GO:0003713	0.787	transcription coactivator activity
GO:0051059	0.734	NF-kappaB binding
GO:0016491	0.669	oxidoreductase activity
GO:0004528	0.360	phosphodiesterase I activity
GO:0052720	0.346	class II DNA-(apurinic or apyrimidinic site) endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0051716	0.986	cellular response to stimulus
GO:0006950	0.985	response to stress
GO:0050794	0.985	regulation of cellular process
GO:0044237	0.977	cellular metabolic process
GO:0048518	0.958	positive regulation of biological process
GO:0044238	0.944	primary metabolic process
GO:0033554	0.936	cellular response to stress
GO:0048522	0.934	positive regulation of cellular process
GO:0006807	0.922	nitrogen compound metabolic process
GO:0043170	0.913	macromolecule metabolic process
GO:0019222	0.912	regulation of metabolic process
GO:0034641	0.862	cellular nitrogen compound metabolic process
GO:0006725	0.860	cellular aromatic compound metabolic process
GO:0006139	0.851	nucleobase-containing compound metabolic process
GO:0044260	0.835	cellular macromolecule metabolic process
GO:0060255	0.766	regulation of macromolecule metabolic process
GO:0048519	0.759	negative regulation of biological process
GO:0090304	0.757	nucleic acid metabolic process
GO:0080090	0.749	regulation of primary metabolic process
GO:0051171	0.732	regulation of nitrogen compound metabolic process
GO:0031323	0.731	regulation of cellular metabolic process
GO:0048523	0.723	negative regulation of cellular process
GO:0006259	0.692	DNA metabolic process
GO:0010941	0.644	regulation of cell death
GO:0009893	0.600	positive regulation of metabolic process
GO:0045454	0.565	cell redox homeostasis
GO:0006281	0.536	DNA repair
GO:0010604	0.486	positive regulation of macromolecule metabolic process
GO:0019219	0.477	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.475	cellular component organization or biogenesis
GO:0031325	0.467	positive regulation of cellular metabolic process
GO:0010468	0.455	regulation of gene expression
GO:0051173	0.449	positive regulation of nitrogen compound metabolic process
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0010556	0.430	regulation of macromolecule biosynthetic process
GO:0016043	0.428	cellular component organization
GO:0045935	0.318	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.994	nucleoplasm
GO:0005737	0.970	cytoplasm
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0032991	0.886	protein-containing complex
GO:0005856	0.612	cytoskeleton
GO:0015630	0.587	microtubule cytoskeleton
GO:0005815	0.446	microtubule organizing center
GO:0005813	0.370	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.995	Phosphoric diester hydrolases.
EC:3.1.21.-	0.986	Endodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.11.-	0.975	Exodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.26.4	0.812	ribonuclease H.
EC:3.2.2.-	0.809	Hydrolyzing N-glycosyl compounds.
EC:1.-.-.-	0.669	Oxidoreductases.
EC:3.1.4.1	0.360	phosphodiesterase I.

[back to server]