StarFunc result for job id P27708

User Input

>input (2225 residues)
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM
KRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLN
ETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVI
DCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASD
PGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHS
LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1bxrA	0.455	0.933	0.000	1073	0.196	0.405	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
2	PDB:5douD	0.620	0.962	0.000	1430	0.329	0.512	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
3	PDB:6uelA	0.567	0.937	0.000	1333	0.309	0.516	6uelA.pdb.gz	Small Molecule Inhibition of CPS1 Activity through an Allosteric Pocket.
4	PDB:6w2jB	0.576	0.932	0.000	1364	0.310	0.506	6w2jB.pdb.gz	Discovery of 2,6-Dimethylpiperazines as Allosteric Inhibitors of CPS1.
5	AFDB:A0A2R8Q0M3	0.628	0.922	0.000	1512	0.351	0.517	A0A2R8Q0M3.pdb.gz
6	AFDB:B2RQC6	0.957	0.957	0.000	2225	0.953	0.953	B2RQC6.pdb.gz	PYR1_MOUSE CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1
7	AFDB:D4A8A0	0.963	0.963	0.000	2224	0.949	0.950	D4A8A0.pdb.gz	D4A8A0_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=3
8	AFDB:O94313	0.461	0.879	0.000	1160	0.263	0.505	O94313.pdb.gz	CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg4 PE=3 SV=1
9	AFDB:P00968	0.452	0.927	0.000	1073	0.195	0.404	P00968.pdb.gz	CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) OX=83333 GN=carB PE=1 SV=2
10	AFDB:P03965	0.458	0.903	0.000	1118	0.262	0.521	P03965.pdb.gz	CARB_YEAST Carbamoyl-phosphate synthase arginine-specific large chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPA2 PE=1 SV=1
11	AFDB:P05990	0.800	0.800	0.000	2224	0.638	0.638	P05990.pdb.gz	PYR1_DROME CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3
12	AFDB:P20054	0.906	0.906	0.000	2225	0.560	0.560	P20054.pdb.gz	PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum OX=44689 GN=pyr1-3 PE=1 SV=3
13	AFDB:P38100	0.460	0.945	0.000	1073	0.192	0.398	P38100.pdb.gz	CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=carB PE=3 SV=3
14	AFDB:P9WPK3	0.456	0.899	0.000	1115	0.189	0.377	P9WPK3.pdb.gz	CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=carB PE=1 SV=1
15	PDB:1jdbF	0.156	0.894	1.370E-35	380	0.065	0.379	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.
16	PDB:2a0fA	0.133	0.919	4.013E-28	310	0.060	0.432	2a0fA.pdb.gz	Structure of the E.coli Aspartate Transcarbamoylase Trapped in the Middle of the Catalytic Cycle.
17	PDB:3csuA	0.124	0.903	8.140E-27	288	0.055	0.427	3csuA.pdb.gz
18	PDB:3e74B	0.144	0.713	1.015E-21	433	0.041	0.212	3e74B.pdb.gz	Crystal structure of metal-dependent allantoinase from Escherichia coli
19	PDB:1c9yA	0.133	0.863	9.581E-21	321	0.035	0.240	1c9yA.pdb.gz	Crystal structure of human ornithine transcarbamylase complexed with carbamoyl phosphate and L-norvaline at 1.9 A resolution.
20	PDB:5nksA	0.146	0.627	2.778E-19	490	0.038	0.173	5nksA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y665	4317	2304	0.950	0.917	A0A8I5Y665_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=3 SV=1
2	A0A8I5ZMM2	4308	2321	0.950	0.910	A0A8I5ZMM2_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=1
3	A0A8I6A9Y4	3794	2154	0.833	0.861	A0A8I6A9Y4_RAT Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=1
4	B2RQC6	4317	2225	0.954	0.954	PYR1_MOUSE CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1
5	D4A8A0	4140	2162	0.918	0.944	D4A8A0_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=3
6	F8VPD4	4402	2162	0.968	0.996	F8VPD4_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=1
7	O93937	2213	2275	0.527	0.515	PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pyrABCN PE=3 SV=2
8	O94313	1134	1160	0.263	0.504	CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg4 PE=3 SV=1
9	P00968	774	1073	0.189	0.392	CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) OX=83333 GN=carB PE=1 SV=2
10	P03965	1128	1118	0.260	0.518	CARB_YEAST Carbamoyl-phosphate synthase arginine-specific large chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPA2 PE=1 SV=1
11	P05990	2867	2224	0.642	0.643	PYR1_DROME CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3
12	P07259	2185	2214	0.512	0.515	PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA2 PE=1 SV=5
13	P07756	1492	1500	0.339	0.503	CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus OX=10116 GN=Cps1 PE=1 SV=1
14	P08955	4377	2225	0.956	0.956	PYR1_MESAU CAD protein OS=Mesocricetus auratus OX=10036 GN=CAD PE=1 SV=4
15	P20054	2536	2225	0.562	0.562	PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum OX=44689 GN=pyr1-3 PE=1 SV=3
16	P25994	830	1071	0.203	0.422	CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) OX=224308 GN=pyrAB PE=1 SV=1
17	P27708	4586	2225	1.000	1.000	PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3
18	P31327	1490	1500	0.337	0.499	CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2
19	P38100	773	1073	0.192	0.398	CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=carB PE=3 SV=3
20	P9WPK3	727	1115	0.191	0.380	CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=carB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01979 Amidohydro_1	1.1e-07	43.1	Amidohydrolase family
2	PF02222 ATP-grasp	2.3e-18	77.9	ATP-grasp domain
3	PF02655 ATP-grasp_3	0.002	29.6	ATP-grasp domain
4	PF13549 ATP-grasp_5	9.6	17.1	ATP-grasp domain
5	PF15632 ATPgrasp_Ter	1.2e-08	46.2	ATP-grasp in the biosynthetic pathway with Ter operon
6	PF02786 CPSase_L_D2	5.2e-109	374.2	Carbamoyl-phosphate synthase L chain, ATP binding domain
7	PF02787 CPSase_L_D3	6.2e-24	95.1	Carbamoyl-phosphate synthetase large chain, oligomerisation domain
8	PF00988 CPSase_sm_chain	1.4e-46	168.8	Carbamoyl-phosphate synthase small chain, CPSase domain
9	PF07478 Dala_Dala_lig_C	4.7e-15	67.2	D-ala D-ala ligase C-terminus
10	PF01071 GARS_A	9.1	17.5	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
11	PF00117 GATase	9.7e-40	147.9	Glutamine amidotransferase class-I
12	PF02142 MGS	4.2e-14	63.9	MGS-like domain
13	PF00185 OTCace	5.3e-30	116.0	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
14	PF02729 OTCace_N	1.7e-40	149.9	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
15	PF07722 Peptidase_C26	0.053	24.8	Peptidase C26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264705

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361471	0.985	Argininosuccinate synthase
2	9606.ENSP00000219240	0.981	Dihydroorotate dehydrogenase (quinone), mitochondrial
3	9606.ENSP00000264220	0.978	Amidophosphoribosyltransferase
4	9606.ENSP00000349860	0.964	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
5	9606.ENSP00000355493	0.964	Adenylosuccinate synthetase isozyme 2
6	9606.ENSP00000333019	0.963	Adenylosuccinate synthetase isozyme 1
7	9606.ENSP00000175506	0.957	Asparagine synthetase
8	9606.ENSP00000359539	0.953	Aspartate aminotransferase, cytoplasmic
9	9606.ENSP00000232607	0.952	Uridine 5'-monophosphate synthase
10	9606.ENSP00000253778	0.951	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
11	9606.ENSP00000307900	0.946	Glutamine synthetase
12	9606.ENSP00000245206	0.930	Aspartate aminotransferase, mitochondrial
13	9606.ENSP00000317379	0.926	Glutaminase kidney isoform, mitochondrial
14	9606.ENSP00000303077	0.919	Putative aspartate aminotransferase, cytoplasmic 2
15	9606.ENSP00000310447	0.911	Glutaminase liver isoform, mitochondrial
16	9606.ENSP00000400057	0.910	Isoaspartyl peptidase/L-asparaginase
17	9606.ENSP00000472474	0.905	L-amino-acid oxidase
18	9606.ENSP00000402608	0.904	Carbamoyl-phosphate synthase [ammonia], mitochondrial
19	9606.ENSP00000413064	0.902	N-acetylaspartate synthetase
20	9606.ENSP00000263080	0.900	Aspartoacylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016812	0.999	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
GO:0016743	0.999	carboxyl- or carbamoyltransferase activity
GO:0004088	0.997	carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0042802	0.996	identical protein binding
GO:0004070	0.993	aspartate carbamoyltransferase activity
GO:0004151	0.976	dihydroorotase activity
GO:0097159	0.450	organic cyclic compound binding
GO:1901363	0.448	heterocyclic compound binding
GO:0036094	0.398	small molecule binding
GO:0043167	0.334	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.991	primary metabolic process
GO:1901566	0.990	organonitrogen compound biosynthetic process
GO:0044271	0.990	cellular nitrogen compound biosynthetic process
GO:0006796	0.983	phosphate-containing compound metabolic process
GO:0019438	0.980	aromatic compound biosynthetic process
GO:0044281	0.975	small molecule metabolic process
GO:1901360	0.975	organic cyclic compound metabolic process
GO:0009165	0.970	nucleotide biosynthetic process
GO:1901137	0.964	carbohydrate derivative biosynthetic process
GO:0006221	0.958	pyrimidine nucleotide biosynthetic process
GO:0006207	0.906	'de novo' pyrimidine nucleobase biosynthetic process
GO:0046390	0.888	ribose phosphate biosynthetic process
GO:0009260	0.883	ribonucleotide biosynthetic process
GO:0009123	0.786	nucleoside monophosphate metabolic process
GO:0006520	0.765	amino acid metabolic process
GO:0009161	0.748	ribonucleoside monophosphate metabolic process
GO:0009218	0.748	pyrimidine ribonucleotide metabolic process
GO:0009124	0.747	nucleoside monophosphate biosynthetic process
GO:0009156	0.730	ribonucleoside monophosphate biosynthetic process
GO:0009129	0.638	pyrimidine nucleoside monophosphate metabolic process
GO:0065007	0.546	biological regulation
GO:1901605	0.525	alpha-amino acid metabolic process
GO:0009064	0.414	glutamine family amino acid metabolic process
GO:0050896	0.319	response to stimulus
GO:0050794	0.317	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.889	intracellular organelle lumen
GO:0032991	0.886	protein-containing complex
GO:0043227	0.846	membrane-bounded organelle
GO:0043231	0.818	intracellular membrane-bounded organelle
GO:0005634	0.742	nucleus
GO:0030054	0.627	cell junction
GO:0031981	0.478	nuclear lumen
GO:0042995	0.425	cell projection
GO:0120025	0.424	plasma membrane bounded cell projection
GO:0045202	0.411	synapse
GO:0043005	0.386	neuron projection
GO:0044297	0.372	cell body
GO:0036477	0.372	somatodendritic compartment
GO:0030424	0.359	axon
GO:0098793	0.353	presynapse
GO:0043025	0.353	neuronal cell body
GO:0150034	0.345	distal axon
GO:0043195	0.322	terminal bouton
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.2.-	0.999	In cyclic amides.
EC:2.1.3.-	0.999	Carboxy- and carbamoyltransferases.
RHEA:18633	0.997	2 ATP + H2O + hydrogencarbonate + L-glutamine = 2 ADP + carbamoyl phosphate + 2 H(+) + L-glutamate + phosphate
EC:6.3.5.5	0.997	carbamoyl-phosphate synthase (glutamine-hydrolyzing).
RHEA:20013	0.993	carbamoyl phosphate + L-aspartate = H(+) + N-carbamoyl-L-aspartate + phosphate
EC:2.1.3.2	0.993	aspartate carbamoyltransferase.
RHEA:24296	0.976	(S)-dihydroorotate + H2O = H(+) + N-carbamoyl-L-aspartate
EC:3.5.2.3	0.976	dihydroorotase.

[back to server]