StarFunc result for job id P27815

User Input

>input (886 residues)
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27815	1.000	1.000	1.240E-99	886	1.000	1.000	P27815.pdb.gz	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
2	AFDB:O89084	0.630	0.660	1.533E-76	844	0.810	0.851	O89084.pdb.gz	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
3	AFDB:A0A140VJR0	0.561	0.613	5.808E-60	809	0.576	0.630	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
4	AFDB:Q01063	0.582	0.687	3.001E-58	747	0.555	0.659	Q01063.pdb.gz	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
5	AFDB:O60658	0.384	0.409	1.471E-21	829	0.157	0.168	O60658.pdb.gz	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
6	AFDB:O88502	0.355	0.382	1.299E-20	823	0.148	0.159	O88502.pdb.gz	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
7	AFDB:A0A0S2Z4T6	0.339	0.502	1.958E-20	593	0.139	0.207	A0A0S2Z4T6.pdb.gz	A0A0S2Z4T6_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
8	AFDB:E7F6Z8	0.344	0.495	4.275E-20	611	0.179	0.260	E7F6Z8.pdb.gz	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
9	AFDB:O70628	0.344	0.562	1.194E-19	534	0.124	0.206	O70628.pdb.gz	PDE9A_MOUSE High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus OX=10090 GN=Pde9a PE=1 SV=1
10	AFDB:Q9N2V9	0.368	0.427	1.528E-19	760	0.147	0.171	Q9N2V9.pdb.gz	PDE6_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-6 OS=Caenorhabditis elegans OX=6239 GN=pde-6 PE=3 SV=1
11	PDB:4y86B	0.343	0.905	1.832E-19	326	0.111	0.301	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:7jsnA	0.325	0.350	9.815E-15	820	0.108	0.117	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.333	0.364	2.326E-14	807	0.099	0.109	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.309	0.842	8.315E-14	311	0.097	0.277	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:6r7xA	0.066	0.086	1.337E-1	629	0.055	0.078	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
16	PDB:7np7D1	0.099	0.142	2.017E-1	485	0.053	0.097	7np7D1.pdb.gz
17	PDB:7b5dA	0.068	0.080	3.042E-1	701	0.059	0.074	7b5dA.pdb.gz
18	PDB:7n6qA	0.078	0.139	5.189E-1	375	0.052	0.123	7n6qA.pdb.gz	Structure of PPPA bound human ACAT2
19	PDB:7p5cA	0.055	0.088	6.117E-1	392	0.044	0.099	7p5cA.pdb.gz
20	PDB:7uzqK	0.075	0.129	6.373E-1	380	0.044	0.103	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJR0	997	809	0.567	0.621	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
2	A0A1B0GW84	964	699	0.538	0.682	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
3	A0A1U7QDZ1	999	804	0.568	0.626	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
4	B1AWC8	963	659	0.549	0.737	B1AWC8_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
5	B1AWC9	965	736	0.549	0.660	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
6	B1AWD0	818	564	0.457	0.718	B1AWD0_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
7	B1AWD1	647	402	0.358	0.789	B1AWD1_MOUSE 3',5'-cyclic-AMP phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
8	O89084	1351	844	0.808	0.848	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
9	P12252	752	1070	0.433	0.359	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
10	P14270	997	803	0.567	0.625	PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4
11	P14644	778	536	0.435	0.718	PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2
12	P14646	962	736	0.547	0.659	PDE4B_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Rattus norvegicus OX=10116 GN=Pde4b PE=1 SV=4
13	P27815	1830	886	1.000	1.000	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
14	P54748	1341	844	0.809	0.850	PDE4A_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Rattus norvegicus OX=10116 GN=Pde4a PE=1 SV=1
15	Q01063	962	747	0.538	0.639	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
16	Q07343	957	736	0.544	0.655	PDE4B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Homo sapiens OX=9606 GN=PDE4B PE=1 SV=1
17	Q08493	912	712	0.530	0.660	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
18	Q08499	997	809	0.567	0.621	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2
19	Q22000	601	674	0.358	0.470	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
20	Q2V4U0	600	673	0.351	0.462	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20242 Emfourin	4.5e+02	12.7	Emfourin
2	PF02445 NadA	3e+02	11.9	Quinolinate synthetase A protein
3	PF18100 PDE4_UCR	5.3e-53	190.2	Phosphodiesterase 4 upstream conserved regions (UCR)
4	PF00233 PDEase_I	1.2e-87	305.1	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370078

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355593	0.990	Disrupted in schizophrenia 1 protein
2	9606.ENSP00000386444	0.987	S-arrestin
3	9606.ENSP00000478212	0.980	A-kinase anchor protein 1, mitochondrial
4	9606.ENSP00000468057	0.971	Heat shock protein beta-6
5	9606.ENSP00000305372	0.922	Beta-2 adrenergic receptor
6	9606.ENSP00000387123	0.915	Alpha-aminoadipic semialdehyde dehydrogenase
7	9606.ENSP00000286621	0.911	Adenosine kinase
8	9606.ENSP00000286648	0.909	Deoxycytidine kinase
9	9606.ENSP00000371230	0.909	GTP:AMP phosphotransferase AK3, mitochondrial
10	9606.ENSP00000485525	0.906	Adenylosuccinate lyase
11	9606.ENSP00000280979	0.904	A-kinase anchor protein 6
12	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
13	9606.ENSP00000228850	0.897	A-kinase anchor protein 3
14	9606.ENSP00000294016	0.892	Adenylate cyclase type 9
15	9606.ENSP00000419361	0.879	Adenylate cyclase type 5
16	9606.ENSP00000311405	0.878	Adenylate cyclase type 6
17	9606.ENSP00000378187	0.871	Adenylate cyclase type 7
18	9606.ENSP00000260600	0.868	Adenylate cyclase type 3
19	9606.ENSP00000286355	0.868	Adenylate cyclase type 8
20	9606.ENSP00000312126	0.863	Adenylate cyclase type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043168	1.000	anion binding
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0017076	0.995	purine nucleotide binding
GO:0032553	0.995	ribonucleotide binding
GO:0032559	0.991	adenyl ribonucleotide binding
GO:0030551	0.988	cyclic nucleotide binding
GO:0030552	0.980	cAMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.986	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.979	response to stimulus
GO:0008152	0.940	metabolic process
GO:0071704	0.934	organic substance metabolic process
GO:0044237	0.924	cellular metabolic process
GO:0044238	0.917	primary metabolic process
GO:0051716	0.909	cellular response to stimulus
GO:0006807	0.896	nitrogen compound metabolic process
GO:1901564	0.892	organonitrogen compound metabolic process
GO:0006796	0.871	phosphate-containing compound metabolic process
GO:0009117	0.856	nucleotide metabolic process
GO:0006163	0.854	purine nucleotide metabolic process
GO:0007165	0.805	signal transduction
GO:0009150	0.797	purine ribonucleotide metabolic process
GO:0046058	0.775	cAMP metabolic process
GO:1901292	0.766	nucleoside phosphate catabolic process
GO:0009154	0.759	purine ribonucleotide catabolic process
GO:0032501	0.655	multicellular organismal process
GO:0042221	0.535	response to chemical
GO:0007186	0.366	G protein-coupled receptor signaling pathway
GO:0010646	0.364	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0043226	0.985	organelle
GO:0005886	0.985	plasma membrane
GO:0043227	0.945	membrane-bounded organelle
GO:0043229	0.896	intracellular organelle
GO:0005634	0.862	nucleus
GO:0070013	0.710	intracellular organelle lumen
GO:0012505	0.566	endomembrane system
GO:0032991	0.537	protein-containing complex
GO:0043232	0.509	intracellular non-membrane-bounded organelle
GO:0031981	0.506	nuclear lumen
GO:0005654	0.457	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.

[back to server]