StarFunc result for job id P27986

User Input

>input (724 residues)
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23727	0.717	0.717	0.000	724	0.968	0.968	P23727.pdb.gz	P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus OX=9913 GN=PIK3R1 PE=1 SV=1
2	AFDB:O00459	0.683	0.680	7.721E-77	728	0.597	0.593	O00459.pdb.gz	P85B_HUMAN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2
3	AFDB:O08908	0.680	0.682	1.511E-75	722	0.601	0.602	O08908.pdb.gz	P85B_MOUSE Phosphatidylinositol 3-kinase regulatory subunit beta OS=Mus musculus OX=10090 GN=Pik3r2 PE=1 SV=2
4	AFDB:Q63789	0.428	0.625	2.951E-51	461	0.457	0.718	Q63789.pdb.gz	P55G_RAT Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3r3 PE=2 SV=1
5	PDB:7myoB	0.376	0.917	2.309E-29	286	0.395	1.000	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
6	AFDB:O18683	0.243	0.313	1.504E-27	506	0.186	0.267	O18683.pdb.gz	O18683_DROME LD42724p OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=2 SV=3
7	PDB:8dcxB	0.317	0.942	1.179E-24	236	0.325	0.996	8dcxB.pdb.gz
8	AFDB:G5EDP9	0.184	0.249	2.103E-19	522	0.156	0.216	G5EDP9.pdb.gz	G5EDP9_CAEEL Phosphoinositide 3-kinase adapter subunit OS=Caenorhabditis elegans OX=6239 GN=aap-1 PE=1 SV=1
9	PDB:4yknA	0.278	0.168	1.904E-17	1205	0.283	0.170	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
10	AFDB:D4A9G6	0.215	0.124	3.737E-11	1310	0.106	0.059	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
11	AFDB:Q20498	0.232	0.223	1.074E-10	759	0.104	0.099	Q20498.pdb.gz	RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans OX=6239 GN=rrc-1 PE=1 SV=3
12	AFDB:A7KAX9	0.220	0.084	3.236E-10	2087	0.106	0.037	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
13	AFDB:F1MAK3	0.218	0.082	7.314E-10	2101	0.088	0.030	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
14	PDB:4fl2A	0.133	0.172	2.094E-8	555	0.097	0.126	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:3cxlA	0.199	0.345	1.235E-7	402	0.059	0.107	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
16	PDB:6r3vA	0.205	0.665	1.902E-7	198	0.051	0.187	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
17	PDB:5c2kA	0.228	0.415	3.224E-7	382	0.051	0.097	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
18	PDB:4k2rA	0.130	0.168	4.965E-7	551	0.087	0.114	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:4gwfA	0.121	0.173	1.070E-6	497	0.080	0.117	4gwfA.pdb.gz
20	PDB:5jcpA	0.223	0.430	2.093E-6	361	0.054	0.108	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C8M4	0.0	847	424	0.555	0.948	E1C8M4_CHICK Phosphoinositide-3-kinase regulatory subunit 1 OS=Gallus gallus OX=9031 GN=PIK3R1 PE=1 SV=2
2	O00459	0.0	801	728	0.583	0.580	P85B_HUMAN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2
3	O08908	0.0	813	722	0.597	0.598	P85B_MOUSE Phosphatidylinositol 3-kinase regulatory subunit beta OS=Mus musculus OX=10090 GN=Pik3r2 PE=1 SV=2
4	P23726	0.0	797	724	0.586	0.586	P85B_BOVIN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Bos taurus OX=9913 GN=PIK3R2 PE=1 SV=1
5	P23727	0.0	1460	724	0.968	0.968	P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus OX=9913 GN=PIK3R1 PE=1 SV=1
6	P26450	0.0	1348	724	0.960	0.960	P85A_MOUSE Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Mus musculus OX=10090 GN=Pik3r1 PE=1 SV=2
7	P27986	0.0	1500	724	1.000	1.000	P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Homo sapiens OX=9606 GN=PIK3R1 PE=1 SV=2
8	Q63787	0.0	1327	724	0.942	0.942	P85A_RAT Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Rattus norvegicus OX=10116 GN=Pik3r1 PE=1 SV=1
9	Q63788	0.0	819	722	0.597	0.598	P85B_RAT Phosphatidylinositol 3-kinase regulatory subunit beta OS=Rattus norvegicus OX=10116 GN=Pik3r2 PE=2 SV=1
10	Q63789	0.0	662	461	0.442	0.694	P55G_RAT Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3r3 PE=2 SV=1
11	Q64143	0.0	667	461	0.442	0.694	P55G_MOUSE Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Mus musculus OX=10090 GN=Pik3r3 PE=1 SV=1
12	Q8N381	0.0	676	461	0.452	0.709	Q8N381_HUMAN Phosphoinositide-3-kinase, regulatory subunit 3 (Gamma) OS=Homo sapiens OX=9606 GN=PIK3R3 PE=1 SV=1
13	Q92569	0.0	677	461	0.452	0.709	P55G_HUMAN Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=PIK3R3 PE=1 SV=2
14	O18683	2.99e-60	213	506	0.192	0.275	O18683_DROME LD42724p OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=2 SV=3
15	Q7KTZ2	3.08e-60	213	496	0.195	0.284	Q7KTZ2_DROME Pi3K21B, isoform B OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=1 SV=1
16	G5EDP9	8.55e-34	138	522	0.174	0.241	G5EDP9_CAEEL Phosphoinositide 3-kinase adapter subunit OS=Caenorhabditis elegans OX=6239 GN=aap-1 PE=1 SV=1
17	M9PAY7	5.70e-26	108	197	0.069	0.254	M9PAY7_DROME Pi3K21B, isoform C OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=1 SV=1
18	Q9Z1N3	1.87e-16	86.7	2626	0.083	0.023	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
19	Q8C170	2.87e-16	86.3	2542	0.083	0.024	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
20	B2RTY4	9.34e-16	84.3	2548	0.081	0.023	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06008 Laminin_I	17	16.6	Laminin Domain I
2	PF14028 Lant_dehydr_C	1.3e+02	13.7	Lantibiotic biosynthesis dehydratase C-term
3	PF07200 Mod_r	6.4e+02	11.8	Modifier of rudimentary (Mod(r)) protein
4	PF16454 PI3K_P85_iSH2	5e-60	213.2	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
5	PF18363 PI_PP_I	73	14.9	Phosphoinositide phosphatase insertion domain
6	PF00620 RhoGAP	1.3e-26	104.6	RhoGAP domain
7	PF00017 SH2	1.1e-37	139.2	SH2 domain
8	PF00018 SH3_1	0.021	25.8	SH3 domain
9	PF07653 SH3_2	1.6	19.9	Variant SH3 domain
10	PF14604 SH3_9	1.8	19.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263967	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
2	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000267101	0.999	Receptor tyrosine-protein kinase erbB-3
4	9606.ENSP00000289153	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
5	9606.ENSP00000304895	0.999	Insulin receptor substrate 1
6	9606.ENSP00000361021	0.999	Phosphatase and tensin homolog
7	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
8	9606.ENSP00000365016	0.999	Insulin receptor substrate 2
9	9606.ENSP00000366563	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
10	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
11	9606.ENSP00000405330	0.999	Estrogen receptor
12	9606.ENSP00000261799	0.998	Platelet-derived growth factor receptor beta
13	9606.ENSP00000340944	0.998	Tyrosine-protein phosphatase non-receptor type 11
14	9606.ENSP00000363822	0.998	Androgen receptor
15	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
16	9606.ENSP00000288135	0.997	Mast/stem cell growth factor receptor Kit
17	9606.ENSP00000269571	0.996	Receptor tyrosine-protein kinase erbB-2
18	9606.ENSP00000354952	0.996	GRB2-associated-binding protein 2
19	9606.ENSP00000383118	0.996	Cell division control protein 42 homolog
20	9606.ENSP00000451828	0.996	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030234	0.995	enzyme regulator activity
GO:0005102	0.995	signaling receptor binding
GO:0019899	0.994	enzyme binding
GO:0035014	0.990	phosphatidylinositol 3-kinase regulator activity
GO:0019901	0.969	protein kinase binding
GO:0030971	0.960	receptor tyrosine kinase binding
GO:0043548	0.937	phosphatidylinositol 3-kinase binding
GO:0035591	0.916	signaling adaptor activity
GO:0030159	0.908	signaling receptor complex adaptor activity
GO:0001784	0.752	phosphotyrosine residue binding
GO:0042802	0.737	identical protein binding
GO:0019902	0.609	phosphatase binding
GO:0003824	0.602	catalytic activity
GO:0019903	0.575	protein phosphatase binding
GO:0016740	0.543	transferase activity
GO:0044877	0.471	protein-containing complex binding
GO:0005068	0.448	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0043560	0.441	insulin receptor substrate binding
GO:0016301	0.438	kinase activity
GO:0016773	0.403	phosphotransferase activity, alcohol group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.992	signal transduction
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048522	0.985	positive regulation of cellular process
GO:0071704	0.979	organic substance metabolic process
GO:0048009	0.979	insulin-like growth factor receptor signaling pathway
GO:0042221	0.970	response to chemical
GO:1901652	0.956	response to peptide
GO:0048523	0.954	negative regulation of cellular process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0009893	0.954	positive regulation of metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0051171	0.951	regulation of nitrogen compound metabolic process
GO:0009719	0.947	response to endogenous stimulus
GO:0070887	0.946	cellular response to chemical stimulus
GO:0060341	0.943	regulation of cellular localization
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0010468	0.942	regulation of gene expression
GO:0031325	0.941	positive regulation of cellular metabolic process
GO:0051173	0.940	positive regulation of nitrogen compound metabolic process
GO:0071375	0.938	cellular response to peptide hormone stimulus
GO:0032880	0.931	regulation of protein localization
GO:0008286	0.926	insulin receptor signaling pathway
GO:1900180	0.904	regulation of protein localization to nucleus
GO:0010628	0.904	positive regulation of gene expression
GO:0010941	0.900	regulation of cell death
GO:0035556	0.886	intracellular signal transduction
GO:0044237	0.857	cellular metabolic process
GO:1903829	0.811	positive regulation of protein localization
GO:0042325	0.808	regulation of phosphorylation
GO:0065009	0.806	regulation of molecular function
GO:0051130	0.805	positive regulation of cellular component organization
GO:0051338	0.783	regulation of transferase activity
GO:0043549	0.774	regulation of kinase activity
GO:0051049	0.773	regulation of transport
GO:0044238	0.770	primary metabolic process
GO:0009889	0.769	regulation of biosynthetic process
GO:0048583	0.768	regulation of response to stimulus
GO:0051050	0.748	positive regulation of transport
GO:0043067	0.736	regulation of programmed cell death
GO:0051252	0.735	regulation of RNA metabolic process
GO:0032386	0.715	regulation of intracellular transport
GO:0010646	0.714	regulation of cell communication
GO:0023051	0.712	regulation of signaling
GO:0006950	0.678	response to stress
GO:0033157	0.668	regulation of intracellular protein transport
GO:0090316	0.664	positive regulation of intracellular protein transport
GO:0048015	0.639	phosphatidylinositol-mediated signaling
GO:1900182	0.631	positive regulation of protein localization to nucleus
GO:0046822	0.628	regulation of nucleocytoplasmic transport
GO:0048584	0.622	positive regulation of response to stimulus
GO:0014065	0.620	phosphatidylinositol 3-kinase signaling
GO:0042306	0.609	regulation of protein import into nucleus
GO:0043550	0.607	regulation of lipid kinase activity
GO:0065008	0.600	regulation of biological quality
GO:0009966	0.584	regulation of signal transduction
GO:0051239	0.579	regulation of multicellular organismal process
GO:0042981	0.572	regulation of apoptotic process
GO:0046824	0.557	positive regulation of nucleocytoplasmic transport
GO:0042307	0.548	positive regulation of protein import into nucleus
GO:0043066	0.498	negative regulation of apoptotic process
GO:0006793	0.491	phosphorus metabolic process
GO:0032501	0.477	multicellular organismal process
GO:0009058	0.458	biosynthetic process
GO:0031326	0.446	regulation of cellular biosynthetic process
GO:0010556	0.440	regulation of macromolecule biosynthetic process
GO:0051246	0.394	regulation of protein metabolic process
GO:0032502	0.393	developmental process
GO:0006796	0.386	phosphate-containing compound metabolic process
GO:0048856	0.380	anatomical structure development
GO:0006807	0.374	nitrogen compound metabolic process
GO:0071840	0.304	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:1902494	0.980	catalytic complex
GO:0071944	0.977	cell periphery
GO:0005886	0.973	plasma membrane
GO:0005942	0.970	phosphatidylinositol 3-kinase complex
GO:0043227	0.956	membrane-bounded organelle
GO:0043229	0.880	intracellular organelle
GO:0043231	0.860	intracellular membrane-bounded organelle
GO:0005634	0.453	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.543	Transferases.
EC:2.7.-.-	0.438	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.403	Phosphotransferases with an alcohol group as acceptor.

[back to server]