StarFunc result for job id P28067

User Input

>input (261 residues)
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVD
GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28067	1.000	1.000	2.803E-48	261	1.000	1.000	P28067.pdb.gz	DMA_HUMAN HLA class II histocompatibility antigen, DM alpha chain OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
2	AFDB:H0Y732	0.839	0.757	8.782E-42	290	0.885	0.797	H0Y732.pdb.gz	H0Y732_HUMAN Major histocompatibility complex, class II, DM alpha (Fragment) OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
3	AFDB:P28078	0.859	0.859	1.361E-38	261	0.743	0.743	P28078.pdb.gz	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
4	AFDB:A2AAT8	0.494	0.753	2.815E-25	166	0.621	0.976	A2AAT8.pdb.gz	A2AAT8_HUMAN HLA class II histocompatibility antigen, DM alpha chain OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
5	AFDB:P01910	0.603	0.614	8.820E-19	256	0.276	0.281	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
6	AFDB:B2RST7	0.598	0.622	3.712E-18	250	0.253	0.264	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
7	AFDB:P20037	0.582	0.592	3.712E-18	256	0.272	0.277	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
8	AFDB:P06340	0.603	0.628	3.915E-18	250	0.245	0.256	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
9	AFDB:P01906	0.597	0.610	4.355E-18	255	0.261	0.267	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
10	AFDB:P20036	0.593	0.595	4.593E-18	260	0.280	0.281	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
11	PDB:6cplA	0.579	0.811	3.407E-14	180	0.180	0.261	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:3es6A	0.339	0.322	2.405E-8	277	0.103	0.097	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:5j6hA	0.320	0.306	2.976E-8	275	0.123	0.116	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:1kjvB	0.331	0.821	5.067E-8	100	0.100	0.260	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
15	PDB:6fgbA	0.299	0.295	7.355E-8	265	0.126	0.125	6fgbA.pdb.gz
16	PDB:2qriA	0.343	0.229	2.133E-7	398	0.103	0.068	2qriA.pdb.gz
17	PDB:1cd1A	0.318	0.306	6.879E-7	273	0.123	0.117	1cd1A.pdb.gz
18	PDB:3s6cA	0.341	0.242	7.651E-7	372	0.103	0.073	3s6cA.pdb.gz
19	PDB:3ov6A	0.321	0.227	9.467E-7	376	0.107	0.074	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:6d7gA	0.335	0.230	1.303E-6	386	0.103	0.070	6d7gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28067	0.0	536	261	1.000	1.000	DMA_HUMAN HLA class II histocompatibility antigen, DM alpha chain OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
2	Q31604	0.0	531	261	0.992	0.992	Q31604_HUMAN DMA protein OS=Homo sapiens OX=9606 GN=DMA PE=2 SV=1
3	Q6ICR9	0.0	531	261	0.992	0.992	Q6ICR9_HUMAN HLA-DMA protein (Fragment) OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
4	H0Y732	3.36e-158	442	290	0.897	0.807	H0Y732_HUMAN Major histocompatibility complex, class II, DM alpha (Fragment) OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
5	P28078	2.40e-138	391	261	0.743	0.743	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
6	A2AAT8	8.33e-94	275	166	0.521	0.819	A2AAT8_HUMAN HLA class II histocompatibility antigen, DM alpha chain OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
7	P01910	2.05e-27	108	256	0.257	0.262	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
8	P20037	2.11e-27	108	256	0.245	0.250	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
9	P04228	1.03e-26	106	256	0.253	0.258	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
10	P14434	4.39e-26	104	256	0.253	0.258	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
11	P23150	4.93e-26	104	254	0.253	0.260	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
12	P14438	4.98e-26	103	227	0.249	0.286	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
13	P14435	1.88e-25	102	233	0.253	0.283	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
14	P14436	2.80e-25	102	233	0.249	0.279	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
15	P14437	7.65e-25	100	233	0.245	0.275	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
16	P06340	1.47e-24	100	250	0.249	0.260	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
17	P04227	2.22e-24	99.4	221	0.249	0.294	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
18	P01906	2.36e-24	100	255	0.245	0.251	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
19	Q95HB9	1.22e-23	98.2	260	0.257	0.258	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
20	P14439	4.84e-23	96.7	255	0.287	0.294	HA23_MOUSE H-2 class II histocompatibility antigen, E-U alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	7.8e-10	50.3	Immunoglobulin C1-set domain
2	PF06743 FAST_1	86	14.5	FAST kinase-like protein, subdomain 1
3	PF00993 MHC_II_alpha	5.9e-17	72.5	Class II histocompatibility antigen, alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398890	0.999	HLA class II histocompatibility antigen, DM beta chain
2	9606.ENSP00000353099	0.998	HLA class II histocompatibility antigen, DRB1-15 beta chain
3	9606.ENSP00000378786	0.997	HLA class II histocompatibility antigen, DR alpha chain
4	9606.ENSP00000009530	0.994	HLA class II histocompatibility antigen gamma chain
5	9606.ENSP00000390020	0.989	HLA class II histocompatibility antigen, DO beta chain
6	9606.ENSP00000229829	0.982	HLA class II histocompatibility antigen, DO alpha chain
7	9606.ENSP00000408146	0.978	HLA class II histocompatibility antigen, DP beta 1 chain
8	9606.ENSP00000390431	0.974	Major histocompatibility complex, class II, DQ beta 2
9	9606.ENSP00000399168	0.969	HLA class I histocompatibility antigen, B-7 alpha chain
10	9606.ENSP00000259951	0.968	HLA class I histocompatibility antigen, alpha chain F
11	9606.ENSP00000379873	0.968	HLA class I histocompatibility antigen, A-3 alpha chain
12	9606.ENSP00000365402	0.965	HLA class I histocompatibility antigen, Cw-7 alpha chain
13	9606.ENSP00000365817	0.963	HLA class I histocompatibility antigen, alpha chain E
14	9606.ENSP00000393566	0.952	HLA class II histocompatibility antigen, DP alpha 1 chain
15	9606.ENSP00000364080	0.949	HLA class II histocompatibility antigen, DQ beta 1 chain
16	9606.ENSP00000364114	0.926	HLA class II histocompatibility antigen, DR beta 5 chain
17	9606.ENSP00000011653	0.849	T-cell surface glycoprotein CD4
18	9606.ENSP00000452780	0.840	Beta-2-microglobulin
19	9606.ENSP00000305918	0.830	Bromodomain-containing protein 3
20	9606.ENSP00000378704	0.820	Bromodomain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0023023	1.000	MHC protein complex binding
GO:0023026	0.486	MHC class II protein complex binding
GO:0033218	0.384	amide binding
GO:0042277	0.368	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002376	0.996	immune system process
GO:0009987	0.995	cellular process
GO:0048002	0.993	antigen processing and presentation of peptide antigen
GO:0002504	0.990	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0002495	0.973	antigen processing and presentation of peptide antigen via MHC class II
GO:0071840	0.959	cellular component organization or biogenesis
GO:0016043	0.888	cellular component organization
GO:0065007	0.866	biological regulation
GO:0050789	0.858	regulation of biological process
GO:0044085	0.820	cellular component biogenesis
GO:0050794	0.791	regulation of cellular process
GO:0022607	0.772	cellular component assembly
GO:0043933	0.767	protein-containing complex organization
GO:0065003	0.763	protein-containing complex assembly
GO:0050896	0.725	response to stimulus
GO:0048518	0.680	positive regulation of biological process
GO:0002682	0.577	regulation of immune system process
GO:0048522	0.534	positive regulation of cellular process
GO:0006955	0.529	immune response
GO:0048583	0.399	regulation of response to stimulus
GO:0002684	0.398	positive regulation of immune system process
GO:0002478	0.397	antigen processing and presentation of exogenous peptide antigen
GO:0051239	0.373	regulation of multicellular organismal process
GO:0050776	0.327	regulation of immune response
GO:0051249	0.326	regulation of lymphocyte activation
GO:0050778	0.321	positive regulation of immune response
GO:0051240	0.303	positive regulation of multicellular organismal process
GO:0019886	0.303	antigen processing and presentation of exogenous peptide antigen via MHC class II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.983	membrane
GO:0012505	0.965	endomembrane system
GO:0071944	0.960	cell periphery
GO:0005737	0.952	cytoplasm
GO:0005886	0.942	plasma membrane
GO:0032991	0.914	protein-containing complex
GO:0031982	0.891	vesicle
GO:0031090	0.821	organelle membrane
GO:0098797	0.818	plasma membrane protein complex
GO:0000323	0.815	lytic vacuole
GO:0005764	0.812	lysosome
GO:0005768	0.802	endosome
GO:0098588	0.773	bounding membrane of organelle
GO:0030659	0.773	cytoplasmic vesicle membrane
GO:0010008	0.676	endosome membrane
GO:0009986	0.622	cell surface
GO:0042611	0.557	MHC protein complex
GO:0005765	0.538	lysosomal membrane
GO:0042613	0.317	MHC class II protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]