StarFunc result for job id P28069

User Input

>input (291 residues)
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHY
GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEE
PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF
KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS
SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10037	0.646	0.646	3.589E-36	291	0.959	0.959	P10037.pdb.gz	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
2	AFDB:H0YNM5	0.392	0.508	3.717E-23	216	0.722	0.972	H0YNM5.pdb.gz	H0YNM5_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU1F1 PE=1 SV=1
3	AFDB:O73861	0.401	0.319	3.319E-14	372	0.378	0.296	O73861.pdb.gz	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
4	AFDB:Q2VUE0	0.452	0.501	5.401E-14	260	0.368	0.412	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
5	AFDB:P20268	0.426	0.334	1.091E-13	380	0.364	0.279	P20268.pdb.gz	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
6	AFDB:Q90435	0.300	0.274	1.874E-13	331	0.337	0.296	Q90435.pdb.gz	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
7	AFDB:F1Q813	0.268	0.228	2.205E-13	368	0.351	0.277	F1Q813.pdb.gz
8	AFDB:O57602	0.426	0.214	3.997E-13	623	0.357	0.167	O57602.pdb.gz	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1
9	AFDB:Q15319	0.271	0.242	5.238E-13	338	0.347	0.299	Q15319.pdb.gz	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
10	AFDB:P25425	0.413	0.173	7.650E-13	770	0.344	0.130	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
11	PDB:6t90K	0.230	0.890	2.907E-5	73	0.141	0.562	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.180	0.108	4.088E-2	539	0.096	0.052	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:6dv9F	0.091	0.131	4.185E-1	174	0.065	0.109	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
14	PDB:4o8bA	0.144	0.351	9.421E-1	101	0.072	0.208	4o8bA.pdb.gz
15	PDB:3pivB	0.088	0.126	1.108	157	0.072	0.134	3pivB.pdb.gz
16	PDB:2hi3A	0.168	0.607	1.376	73	0.041	0.164	2hi3A.pdb.gz
17	PDB:7enah	0.113	0.161	1.452	190	0.093	0.142	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:7fbyA	0.136	0.235	1.452	153	0.038	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
19	PDB:3f51A	0.142	0.390	1.803	94	0.065	0.202	3f51A.pdb.gz
20	PDB:7tbhA	0.127	0.146	2.633	243	0.072	0.086	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10037	0.0	585	291	0.959	0.959	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
2	P28069	0.0	609	291	1.000	1.000	PIT1_HUMAN Pituitary-specific positive transcription factor 1 OS=Homo sapiens OX=9606 GN=POU1F1 PE=1 SV=1
3	Q00286	0.0	587	291	0.955	0.955	PIT1_MOUSE Pituitary-specific positive transcription factor 1 OS=Mus musculus OX=10090 GN=Pou1f1 PE=1 SV=1
4	Q6TGI4	5.33e-137	392	350	0.704	0.586	Q6TGI4_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pit1 PE=2 SV=1
5	Q08478	1.64e-123	358	358	0.708	0.575	PIT1_ONCMY Pituitary-specific positive transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=pou1f1 PE=2 SV=1
6	H0YNM5	6.94e-103	301	216	0.502	0.676	H0YNM5_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU1F1 PE=1 SV=1
7	P16241	6.35e-59	196	427	0.313	0.213	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
8	Q2VUE0	2.59e-58	189	260	0.316	0.354	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
9	O73861	3.19e-58	192	372	0.368	0.288	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
10	P20265	7.79e-57	191	443	0.313	0.205	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
11	P31360	8.15e-57	191	445	0.313	0.204	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
12	P49335	9.08e-57	188	361	0.409	0.330	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
13	P20264	9.56e-57	192	500	0.316	0.184	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
14	P31361	1.21e-56	191	497	0.316	0.185	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2
15	Q63262	1.25e-56	191	497	0.316	0.185	PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou3f3 PE=1 SV=2
16	A0A2R8Y739	1.62e-56	187	361	0.409	0.330	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
17	P62515	2.16e-56	187	361	0.375	0.302	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
18	P62516	2.16e-56	187	361	0.375	0.302	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
19	P56222	2.24e-56	189	445	0.309	0.202	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
20	P79746	7.10e-56	186	378	0.302	0.233	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	52	15.2	Homeobox KN domain
2	PF00046 Homeodomain	7.6e-15	65.8	Homeodomain
3	PF11774 Lsr2	3e+02	12.9	Lsr2
4	PF00157 Pou	3e-32	121.7	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002234

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000015117	0.598	Cone-rod homeobox
2	60711.ENSCSAP00000003966	0.531	Prolactin
3	60711.ENSCSAP00000005594	0.501	BRCA1 associated RING domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.997	DNA-binding transcription activator activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0001228	0.977	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.975	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.965	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.957	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003723	0.740	RNA binding
GO:0140297	0.447	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.994	positive regulation of biological process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0048522	0.965	positive regulation of cellular process
GO:0006357	0.942	regulation of transcription by RNA polymerase II
GO:0009893	0.937	positive regulation of metabolic process
GO:0010604	0.933	positive regulation of macromolecule metabolic process
GO:0010557	0.921	positive regulation of macromolecule biosynthetic process
GO:0031328	0.918	positive regulation of cellular biosynthetic process
GO:0051173	0.913	positive regulation of nitrogen compound metabolic process
GO:0051254	0.896	positive regulation of RNA metabolic process
GO:0045893	0.886	positive regulation of DNA-templated transcription
GO:0032502	0.866	developmental process
GO:0032501	0.850	multicellular organismal process
GO:0048856	0.850	anatomical structure development
GO:0045944	0.821	positive regulation of transcription by RNA polymerase II
GO:0048523	0.789	negative regulation of cellular process
GO:0007275	0.653	multicellular organism development
GO:0009987	0.651	cellular process
GO:0048731	0.558	system development
GO:0051172	0.315	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.987	intracellular organelle lumen
GO:0005654	0.975	nucleoplasm
GO:0032991	0.720	protein-containing complex
GO:0005737	0.562	cytoplasm
GO:0043232	0.368	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]