StarFunc result for job id P28070

User Input

>input (264 residues)
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSTETNWDIAHMISGFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK46	0.891	0.891	5.487E-52	264	1.000	1.000	A0A140VK46.pdb.gz	A0A140VK46_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:5ln37	0.754	0.905	1.000E-33	218	0.826	1.000	5ln37.pdb.gz	Molecular Details Underlying Dynamic Structures and Regulation of the Human 26S Proteasome.
3	AFDB:Q9VNA5	0.802	0.791	2.006E-30	268	0.386	0.381	Q9VNA5.pdb.gz	PSB4_DROME Proteasome subunit beta type-4 OS=Drosophila melanogaster OX=7227 GN=Prosbeta7 PE=2 SV=1
4	AFDB:Q7DLR9	0.795	0.852	4.885E-30	246	0.379	0.407	Q7DLR9.pdb.gz	PSB4_ARATH Proteasome subunit beta type-4 OS=Arabidopsis thaliana OX=3702 GN=PBG1 PE=1 SV=2
5	AFDB:Q9USQ9	0.822	0.828	2.572E-29	262	0.379	0.382	Q9USQ9.pdb.gz	PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC577.10 PE=3 SV=1
6	AFDB:Q556Q0	0.803	0.818	4.386E-29	259	0.383	0.390	Q556Q0.pdb.gz	PSB4_DICDI Proteasome subunit beta type-4 OS=Dictyostelium discoideum OX=44689 GN=psmB4-1 PE=3 SV=1
7	AFDB:P30657	0.814	0.808	9.587E-28	266	0.379	0.376	P30657.pdb.gz	PSB7_YEAST Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE4 PE=1 SV=1
8	PDB:5l5wM	0.789	0.892	5.355E-26	233	0.375	0.425	5l5wM.pdb.gz	A humanized yeast proteasome identifies unique binding modes of inhibitors for the immunosubunit beta 5i.
9	AFDB:D6XEX9	0.760	0.918	1.103E-25	218	0.337	0.408	D6XEX9.pdb.gz	D6XEX9_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.530 PE=3 SV=1
10	AFDB:A0A140VK45	0.711	0.776	5.246E-18	241	0.197	0.216	A0A140VK45.pdb.gz	A0A140VK45_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
11	AFDB:Q86A21	0.714	0.795	1.204E-17	236	0.201	0.225	Q86A21.pdb.gz	PSB1_DICDI Proteasome subunit beta type-1 OS=Dictyostelium discoideum OX=44689 GN=psmB1 PE=3 SV=1
12	AFDB:O62102	0.701	0.670	2.312E-17	277	0.174	0.166	O62102.pdb.gz	O62102_CAEEL Proteasome subunit beta OS=Caenorhabditis elegans OX=6239 GN=pbs-2 PE=1 SV=1
13	PDB:8cvsL	0.705	0.866	3.675E-17	213	0.186	0.230	8cvsL.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.
14	PDB:5fgiH	0.690	0.773	1.370E-15	234	0.163	0.184	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
15	PDB:1j2qH	0.667	0.862	1.637E-15	202	0.167	0.218	1j2qH.pdb.gz	Investigations on the Maturation and Regulation of Archaebacterial Proteasomes
16	PDB:4r3oK	0.675	0.882	2.631E-15	199	0.152	0.201	4r3oK.pdb.gz
17	PDB:5ahjL	0.709	0.834	6.797E-15	222	0.163	0.194	5ahjL.pdb.gz	Macyranones: Structure, Biosynthesis, and Binding Mode of an Unprecedented Epoxyketone that Targets the 20S Proteasome.
18	PDB:3e47J	0.645	0.848	8.617E-15	198	0.148	0.197	3e47J.pdb.gz	Inhibitor-binding mode of homobelactosin C to proteasomes: new insights into class I MHC ligand generation
19	PDB:5fgiN	0.658	0.805	1.305E-14	213	0.155	0.192	5fgiN.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
20	PDB:8cvtR	0.666	0.863	1.470E-14	201	0.170	0.224	8cvtR.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK46	0.0	543	264	1.000	1.000	A0A140VK46_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	P28070	0.0	543	264	1.000	1.000	PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4
3	P99026	0.0	510	264	0.939	0.939	PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus OX=10090 GN=Psmb4 PE=1 SV=1
4	Q7DLR9	3.38e-69	215	246	0.371	0.398	PSB4_ARATH Proteasome subunit beta type-4 OS=Arabidopsis thaliana OX=3702 GN=PBG1 PE=1 SV=2
5	Q556Q0	8.56e-68	212	259	0.360	0.367	PSB4_DICDI Proteasome subunit beta type-4 OS=Dictyostelium discoideum OX=44689 GN=psmB4-1 PE=3 SV=1
6	Q9USQ9	3.46e-67	211	262	0.367	0.370	PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC577.10 PE=3 SV=1
7	Q9VNA5	2.19e-63	201	268	0.390	0.384	PSB4_DROME Proteasome subunit beta type-4 OS=Drosophila melanogaster OX=7227 GN=Prosbeta7 PE=2 SV=1
8	P30657	4.19e-62	198	266	0.379	0.376	PSB7_YEAST Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE4 PE=1 SV=1
9	D6XEX9	9.70e-53	172	218	0.337	0.408	D6XEX9_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.530 PE=3 SV=1
10	Q9BMX8	9.70e-53	172	218	0.337	0.408	Q9BMX8_9TRYP Proteasome subunit beta OS=Trypanosoma brucei OX=5691 PE=2 SV=1
11	Q8IJT1	7.15e-10	60.5	271	0.205	0.199	Q8IJT1_PLAF7 Proteasome subunit beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1011400 PE=1 SV=1
12	Q38AZ8	3.14e-09	58.9	310	0.220	0.187	Q38AZ8_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0790 PE=3 SV=1
13	Q9GRG9	3.14e-09	58.9	310	0.220	0.187	Q9GRG9_9TRYP Proteasome subunit beta OS=Trypanosoma brucei OX=5691 GN=PRCE PE=2 SV=1
14	D4GYZ1	3.97e-09	57.8	243	0.235	0.255	PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=psmB PE=1 SV=1
15	Q58634	2.49e-08	55.5	224	0.178	0.210	PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=psmB PE=1 SV=1
16	Q9VJJ0	2.54e-08	55.1	201	0.163	0.214	Q9VJJ0_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta4 PE=1 SV=1
17	P30655	2.89e-07	52.8	272	0.223	0.217	PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pts1 PE=3 SV=3
18	P28062	3.59e-07	52.4	276	0.231	0.221	PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens OX=9606 GN=PSMB8 PE=1 SV=3
19	P28064	8.68e-07	51.2	276	0.197	0.188	PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus OX=10116 GN=Psmb8 PE=1 SV=3
20	A0AQH0	1.37e-06	50.1	224	0.182	0.214	A0AQH0_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08725 Integrin_b_cyt	40	15.3	Integrin beta cytoplasmic domain
2	PF00227 Proteasome	8.8e-30	115.1	Proteasome subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000044462	0.999	Proteasome subunit alpha type-4
2	9606.ENSP00000157812	0.999	26S proteasome regulatory subunit 6B
3	9606.ENSP00000215071	0.999	26S proteasome non-ATPase regulatory subunit 8
4	9606.ENSP00000216455	0.999	Proteasome subunit alpha type-3
5	9606.ENSP00000219313	0.999	26S proteasome non-ATPase regulatory subunit 7
6	9606.ENSP00000223321	0.999	Proteasome subunit alpha type-2
7	9606.ENSP00000259457	0.999	Proteasome subunit beta type-7
8	9606.ENSP00000261303	0.999	26S proteasome regulatory subunit 4
9	9606.ENSP00000261479	0.999	Proteasome subunit alpha type-6
10	9606.ENSP00000261712	0.999	26S proteasome non-ATPase regulatory subunit 11
11	9606.ENSP00000262193	0.999	Proteasome subunit beta type-1
12	9606.ENSP00000264639	0.999	26S proteasome non-ATPase regulatory subunit 3
13	9606.ENSP00000270586	0.999	Proteasome subunit beta type-6
14	9606.ENSP00000271308	0.999	Proteasome subunit alpha type-5
15	9606.ENSP00000309474	0.999	26S proteasome non-ATPase regulatory subunit 1
16	9606.ENSP00000310129	0.999	26S proteasome non-ATPase regulatory subunit 2
17	9606.ENSP00000310572	0.999	26S proteasome regulatory subunit 8
18	9606.ENSP00000311121	0.999	Proteasome subunit alpha type-7-like
19	9606.ENSP00000348442	0.999	26S proteasome non-ATPase regulatory subunit 12
20	9606.ENSP00000351314	0.999	Proteasome subunit beta type-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0008233	0.710	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.956	regulation of biological process
GO:0048519	0.826	negative regulation of biological process
GO:0048583	0.809	regulation of response to stimulus
GO:0031347	0.784	regulation of defense response
GO:0032101	0.774	regulation of response to external stimulus
GO:0050727	0.733	regulation of inflammatory response
GO:0032102	0.728	negative regulation of response to external stimulus
GO:0031348	0.681	negative regulation of defense response
GO:0002682	0.668	regulation of immune system process
GO:0002861	0.640	regulation of inflammatory response to antigenic stimulus
GO:0050777	0.632	negative regulation of immune response
GO:0050728	0.594	negative regulation of inflammatory response
GO:0009987	0.491	cellular process
GO:0071704	0.478	organic substance metabolic process
GO:0044238	0.461	primary metabolic process
GO:0006807	0.438	nitrogen compound metabolic process
GO:0043170	0.416	macromolecule metabolic process
GO:1901564	0.388	organonitrogen compound metabolic process
GO:0019538	0.379	protein metabolic process
GO:0050794	0.336	regulation of cellular process
GO:0050896	0.332	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0000502	0.996	proteasome complex
GO:0005839	0.979	proteasome core complex
GO:0005739	0.820	mitochondrion
GO:1903561	0.735	extracellular vesicle
GO:0043228	0.725	non-membrane-bounded organelle
GO:0070062	0.722	extracellular exosome
GO:0043232	0.647	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.710	Acting on peptide bonds (peptidases).

[back to server]