StarFunc result for job id P28074

User Input

>input (263 residues)
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55234	0.871	0.868	8.184E-43	264	0.932	0.928	O55234.pdb.gz	PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus OX=10090 GN=Psmb5 PE=1 SV=3
2	PDB:8cvtR	0.753	0.982	1.349E-35	201	0.764	1.000	8cvtR.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.
3	AFDB:P28062	0.792	0.755	3.494E-35	276	0.586	0.558	P28062.pdb.gz	PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens OX=9606 GN=PSMB8 PE=1 SV=3
4	AFDB:P28063	0.789	0.752	1.162E-34	276	0.605	0.576	P28063.pdb.gz	PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus OX=10090 GN=Psmb8 PE=1 SV=2
5	AFDB:Q38AZ8	0.804	0.683	2.152E-33	310	0.544	0.461	Q38AZ8.pdb.gz	Q38AZ8_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0790 PE=3 SV=1
6	AFDB:Q54BC8	0.790	0.764	9.000E-33	272	0.536	0.518	Q54BC8.pdb.gz	PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum OX=44689 GN=psmB5 PE=1 SV=1
7	AFDB:Q9LIP2	0.792	0.763	1.009E-32	273	0.540	0.520	Q9LIP2.pdb.gz	PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana OX=3702 GN=PBE2 PE=1 SV=1
8	AFDB:P30656	0.781	0.717	2.670E-32	287	0.521	0.477	P30656.pdb.gz	PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE2 PE=1 SV=3
9	AFDB:Q7K148	0.775	0.724	3.170E-32	282	0.498	0.465	Q7K148.pdb.gz	Q7K148_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta5 PE=1 SV=1
10	AFDB:P30655	0.774	0.750	1.667E-31	272	0.487	0.471	P30655.pdb.gz	PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pts1 PE=3 SV=3
11	AFDB:F4HP14	0.779	0.689	4.944E-31	298	0.551	0.487	F4HP14.pdb.gz	F4HP14_ARATH 20S proteasome beta subunit E1 OS=Arabidopsis thaliana OX=3702 GN=PBE1 PE=1 SV=1
12	PDB:6e5bK	0.755	0.974	3.963E-30	203	0.529	0.685	6e5bK.pdb.gz	Design and Evaluation of Highly Selective Human Immunoproteasome Inhibitors Reveal a Compensatory Process That Preserves Immune Cell Viability.
13	PDB:3nzjK	0.749	0.925	6.930E-29	212	0.510	0.632	3nzjK.pdb.gz	20S proteasome inhibition: designing noncovalent linear peptide mimics of the natural product TMC-95A.
14	PDB:7ls6L	0.589	0.867	1.168E-20	177	0.411	0.610	7ls6L.pdb.gz
15	PDB:1j2qH	0.700	0.901	5.334E-18	202	0.243	0.317	1j2qH.pdb.gz	Investigations on the Maturation and Regulation of Archaebacterial Proteasomes
16	PDB:1pma1	0.713	0.915	5.334E-18	203	0.228	0.296	1pma1.pdb.gz
17	PDB:5fgiN	0.716	0.877	1.001E-17	213	0.198	0.244	5fgiN.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
18	PDB:5fgiH	0.690	0.773	1.494E-17	234	0.202	0.226	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
19	PDB:3h4pa	0.702	0.904	7.007E-17	202	0.240	0.312	3h4pa.pdb.gz
20	PDB:5ln31	0.671	0.815	2.078E-16	214	0.232	0.285	5ln31.pdb.gz	Molecular Details Underlying Dynamic Structures and Regulation of the Human 26S Proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55234	0.0	501	264	0.932	0.928	PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus OX=10090 GN=Psmb5 PE=1 SV=3
2	P28074	0.0	536	263	1.000	1.000	PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3
3	A0A140VJS7	1.65e-115	330	160	0.608	1.000	A0A140VJS7_HUMAN proteasome endopeptidase complex OS=Homo sapiens OX=9606 PE=2 SV=1
4	P28064	1.70e-109	319	276	0.567	0.540	PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus OX=10116 GN=Psmb8 PE=1 SV=3
5	P28063	2.03e-108	316	276	0.563	0.536	PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus OX=10090 GN=Psmb8 PE=1 SV=2
6	P28062	2.23e-106	311	276	0.548	0.522	PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens OX=9606 GN=PSMB8 PE=1 SV=3
7	Q54BC8	3.40e-102	300	272	0.536	0.518	PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum OX=44689 GN=psmB5 PE=1 SV=1
8	Q7K148	3.96e-100	295	282	0.521	0.486	Q7K148_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta5 PE=1 SV=1
9	Q9NHX7	4.27e-100	295	282	0.521	0.486	Q9NHX7_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta5 PE=3 SV=1
10	Q9LIP2	1.84e-99	293	273	0.570	0.549	PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana OX=3702 GN=PBE2 PE=1 SV=1
11	P30656	1.22e-95	284	287	0.521	0.477	PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE2 PE=1 SV=3
12	Q38AZ8	2.03e-93	279	310	0.510	0.432	Q38AZ8_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0790 PE=3 SV=1
13	Q9GRG9	2.03e-93	279	310	0.510	0.432	Q9GRG9_9TRYP Proteasome subunit beta OS=Trypanosoma brucei OX=5691 GN=PRCE PE=2 SV=1
14	F4HP14	1.09e-92	277	298	0.563	0.497	F4HP14_ARATH 20S proteasome beta subunit E1 OS=Arabidopsis thaliana OX=3702 GN=PBE1 PE=1 SV=1
15	P30655	2.14e-90	270	272	0.475	0.460	PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pts1 PE=3 SV=3
16	Q5B698	4.89e-81	247	296	0.468	0.416	Q5B698_EMENI proteasome endopeptidase complex OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03932 PE=4 SV=1
17	Q8IJT1	3.00e-77	237	271	0.411	0.399	Q8IJT1_PLAF7 Proteasome subunit beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1011400 PE=1 SV=1
18	A5LHX3	2.73e-72	225	300	0.441	0.387	PSB11_HUMAN Proteasome subunit beta type-11 OS=Homo sapiens OX=9606 GN=PSMB11 PE=1 SV=1
19	Q8BG41	7.47e-69	216	302	0.433	0.377	PSB11_MOUSE Proteasome subunit beta type-11 OS=Mus musculus OX=10090 GN=Psmb11 PE=1 SV=1
20	G3V3K3	2.98e-40	136	84	0.251	0.786	G3V3K3_HUMAN Proteasome 20S subunit beta 5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13154 DUF3991	1.8e+02	14.0	Protein of unknown function (DUF3991)
2	PF00227 Proteasome	8.9e-45	164.1	Proteasome subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000044462	0.999	Proteasome subunit alpha type-4
2	9606.ENSP00000157812	0.999	26S proteasome regulatory subunit 6B
3	9606.ENSP00000215071	0.999	26S proteasome non-ATPase regulatory subunit 8
4	9606.ENSP00000216455	0.999	Proteasome subunit alpha type-3
5	9606.ENSP00000219313	0.999	26S proteasome non-ATPase regulatory subunit 7
6	9606.ENSP00000223321	0.999	Proteasome subunit alpha type-2
7	9606.ENSP00000259457	0.999	Proteasome subunit beta type-7
8	9606.ENSP00000261303	0.999	26S proteasome regulatory subunit 4
9	9606.ENSP00000261479	0.999	Proteasome subunit alpha type-6
10	9606.ENSP00000261712	0.999	26S proteasome non-ATPase regulatory subunit 11
11	9606.ENSP00000262193	0.999	Proteasome subunit beta type-1
12	9606.ENSP00000264639	0.999	26S proteasome non-ATPase regulatory subunit 3
13	9606.ENSP00000270586	0.999	Proteasome subunit beta type-6
14	9606.ENSP00000271308	0.999	Proteasome subunit alpha type-5
15	9606.ENSP00000290541	0.999	Proteasome subunit beta type-4
16	9606.ENSP00000309474	0.999	26S proteasome non-ATPase regulatory subunit 1
17	9606.ENSP00000310129	0.999	26S proteasome non-ATPase regulatory subunit 2
18	9606.ENSP00000310572	0.999	26S proteasome regulatory subunit 8
19	9606.ENSP00000348442	0.999	26S proteasome non-ATPase regulatory subunit 12
20	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005515	0.999	protein binding
GO:0004175	0.908	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0009987	0.972	cellular process
GO:0043170	0.963	macromolecule metabolic process
GO:1901564	0.940	organonitrogen compound metabolic process
GO:0006508	0.891	proteolysis
GO:0044237	0.543	cellular metabolic process
GO:0044260	0.453	cellular macromolecule metabolic process
GO:0051603	0.451	proteolysis involved in protein catabolic process
GO:0050896	0.432	response to stimulus
GO:0044265	0.356	cellular macromolecule catabolic process
GO:0019941	0.317	modification-dependent protein catabolic process
GO:0006511	0.304	ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0000502	0.998	proteasome complex
GO:0005839	0.983	proteasome core complex
GO:0031982	0.754	vesicle
GO:0065010	0.736	extracellular membrane-bounded organelle
GO:1903561	0.729	extracellular vesicle
GO:0070062	0.724	extracellular exosome
GO:0043232	0.392	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]