StarFunc result for job id P28223

User Input

>input (471 residues)
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O46635	0.810	0.812	1.310E-51	470	0.936	0.938	O46635.pdb.gz	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
2	AFDB:P14842	0.812	0.812	1.367E-51	471	0.913	0.913	P14842.pdb.gz	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
3	AFDB:P08909	0.659	0.675	1.187E-30	460	0.486	0.498	P08909.pdb.gz	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
4	AFDB:Q8UUG8	0.663	0.663	3.986E-29	471	0.431	0.431	Q8UUG8.pdb.gz	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
5	AFDB:P41595	0.617	0.606	4.033E-28	481	0.406	0.397	P41595.pdb.gz	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
6	AFDB:Q50DZ8	0.621	0.673	8.723E-28	434	0.403	0.438	Q50DZ8.pdb.gz	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
7	AFDB:Q02152	0.607	0.597	2.547E-27	479	0.416	0.409	Q02152.pdb.gz	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
8	AFDB:P30994	0.623	0.614	9.211E-27	479	0.389	0.382	P30994.pdb.gz	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
9	AFDB:O17470	0.647	0.455	1.724E-20	683	0.268	0.184	O17470.pdb.gz	O17470_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
10	AFDB:Q4LBB9	0.611	0.540	2.678E-19	536	0.253	0.222	Q4LBB9.pdb.gz	OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster OX=7227 GN=Octbeta2R PE=2 SV=2
11	PDB:7e32R	0.516	0.830	1.838E-15	285	0.206	0.340	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
12	PDB:6iblA	0.532	0.624	2.002E-15	397	0.231	0.275	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7cmuR	0.515	0.868	1.020E-14	272	0.210	0.364	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
14	PDB:3pblA	0.535	0.581	1.707E-14	432	0.225	0.245	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
15	PDB:7jvqR	0.499	0.799	2.026E-14	286	0.206	0.339	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:7jvrR	0.520	0.885	2.735E-14	269	0.223	0.390	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7e33R	0.484	0.859	3.110E-14	257	0.210	0.385	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:7xt8R	0.496	0.768	6.173E-14	294	0.204	0.327	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
19	PDB:7xtbR	0.490	0.802	1.654E-13	278	0.206	0.349	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:7xtcR	0.502	0.832	1.802E-13	275	0.206	0.353	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O46635	0.0	904	470	0.936	0.938	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
2	P14842	0.0	887	471	0.913	0.913	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
3	P28223	0.0	971	471	1.000	1.000	5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens OX=9606 GN=HTR2A PE=1 SV=2
4	P35363	0.0	892	471	0.915	0.915	5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus OX=10090 GN=Htr2a PE=1 SV=1
5	P08909	1.13e-149	436	460	0.486	0.498	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
6	P34968	2.01e-148	433	459	0.484	0.497	5HT2C_MOUSE 5-hydroxytryptamine receptor 2C OS=Mus musculus OX=10090 GN=Htr2c PE=1 SV=2
7	G1NQ48	3.16e-148	427	308	0.442	0.675	G1NQ48_MELGA 5-hydroxytryptamine receptor 2A OS=Meleagris gallopavo OX=9103 PE=3 SV=2
8	P28335	1.83e-140	412	458	0.480	0.493	5HT2C_HUMAN 5-hydroxytryptamine receptor 2C OS=Homo sapiens OX=9606 GN=HTR2C PE=1 SV=2
9	Q50DZ8	4.03e-125	372	434	0.408	0.442	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
10	Q8UUG8	4.59e-124	371	471	0.448	0.448	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
11	P41595	1.78e-123	370	481	0.395	0.387	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
12	Q02152	1.15e-122	368	479	0.401	0.395	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
13	P30994	1.73e-121	365	479	0.397	0.390	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
14	G3MWM5	1.10e-52	184	414	0.259	0.295	G3MWM5_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=1
15	A0A060X727	7.17e-52	182	388	0.263	0.320	A0A060X727_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020782001 PE=3 SV=1
16	P41596	1.23e-51	184	511	0.263	0.243	DOPR1_DROME Dopamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=Dop1R1 PE=2 SV=2
17	A0A060Y1K1	7.61e-51	179	405	0.261	0.304	A0A060Y1K1_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00043261001 PE=3 SV=1
18	P28566	8.31e-51	178	365	0.246	0.318	5HT1E_HUMAN 5-hydroxytryptamine receptor 1E OS=Homo sapiens OX=9606 GN=HTR1E PE=1 SV=1
19	Q8INQ6	4.49e-49	182	904	0.178	0.093	Q8INQ6_DROME 5-hydroxytryptamine (Serotonin) receptor 2B, isoform D OS=Drosophila melanogaster OX=7227 GN=5-HT2B PE=2 SV=2
20	A0A0B4KFU6	5.02e-49	182	947	0.178	0.089	A0A0B4KFU6_DROME 5-hydroxytryptamine (Serotonin) receptor 2B, isoform E OS=Drosophila melanogaster OX=7227 GN=5-HT2B PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.3e-64	229.6	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.035	25.5	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	3.1e-12	58.0	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10328 7TM_GPCR_Srx	0.16	23.1	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.995	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000378492	0.993	Metabotropic glutamate receptor 2
3	9606.ENSP00000276198	0.928	5-hydroxytryptamine receptor 2C
4	9606.ENSP00000261707	0.914	Sodium-dependent serotonin transporter
5	9606.ENSP00000078429	0.872	Guanine nucleotide-binding protein subunit alpha-11
6	9606.ENSP00000258400	0.868	5-hydroxytryptamine receptor 2B
7	9606.ENSP00000355316	0.825	Metabotropic glutamate receptor 3
8	9606.ENSP00000382428	0.822	Disks large homolog 4
9	9606.ENSP00000250018	0.806	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
10	9606.ENSP00000340684	0.782	Amine oxidase [flavin-containing] A
11	9606.ENSP00000354511	0.769	Catechol O-methyltransferase
12	9606.ENSP00000347754	0.756	5-hydroxytryptamine receptor 3A
13	9606.ENSP00000266376	0.749	Voltage-dependent L-type calcium channel subunit alpha-1C
14	9606.ENSP00000414303	0.742	Brain-derived neurotrophic factor
15	9606.ENSP00000403701	0.740	Beta-arrestin-2
16	9606.ENSP00000408292	0.731	E3 ubiquitin-protein ligase TRIM32
17	9606.ENSP00000381333	0.729	Corticotropin-releasing factor receptor 1
18	9606.ENSP00000270349	0.718	Sodium-dependent dopamine transporter
19	9606.ENSP00000386444	0.712	S-arrestin
20	9606.ENSP00000440005	0.711	ADP-ribosylation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004993	1.000	G protein-coupled serotonin receptor activity
GO:0043169	0.999	cation binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0005515	0.995	protein binding
GO:0043176	0.994	amine binding
GO:0044877	0.794	protein-containing complex binding
GO:0042802	0.699	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050896	0.980	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0023052	0.970	signaling
GO:0007154	0.970	cell communication
GO:0051716	0.967	cellular response to stimulus
GO:0007165	0.953	signal transduction
GO:0042221	0.943	response to chemical
GO:0098660	0.939	inorganic ion transmembrane transport
GO:0006811	0.938	monoatomic ion transport
GO:0070588	0.931	calcium ion transmembrane transport
GO:0048519	0.930	negative regulation of biological process
GO:0048518	0.921	positive regulation of biological process
GO:0097553	0.910	calcium ion transmembrane import into cytosol
GO:0007186	0.903	G protein-coupled receptor signaling pathway
GO:0032879	0.897	regulation of localization
GO:0051282	0.889	regulation of sequestering of calcium ion
GO:0051283	0.883	negative regulation of sequestering of calcium ion
GO:0032501	0.862	multicellular organismal process
GO:0065009	0.851	regulation of molecular function
GO:1903351	0.817	cellular response to dopamine
GO:0019222	0.811	regulation of metabolic process
GO:0031323	0.758	regulation of cellular metabolic process
GO:0051209	0.741	release of sequestered calcium ion into cytosol
GO:0051174	0.731	regulation of phosphorus metabolic process
GO:0009893	0.705	positive regulation of metabolic process
GO:0019220	0.703	regulation of phosphate metabolic process
GO:0048522	0.690	positive regulation of cellular process
GO:0007210	0.682	serotonin receptor signaling pathway
GO:0010562	0.629	positive regulation of phosphorus metabolic process
GO:0044093	0.619	positive regulation of molecular function
GO:0010646	0.584	regulation of cell communication
GO:0023051	0.580	regulation of signaling
GO:0009410	0.485	response to xenobiotic stimulus
GO:0045937	0.453	positive regulation of phosphate metabolic process
GO:0080090	0.422	regulation of primary metabolic process
GO:0050790	0.348	regulation of catalytic activity
GO:0044237	0.342	cellular metabolic process
GO:0007267	0.323	cell-cell signaling
GO:0065008	0.316	regulation of biological quality
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.981	protein-containing complex
GO:0043235	0.951	receptor complex
GO:0043231	0.742	intracellular membrane-bounded organelle
GO:0005737	0.698	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]