StarFunc result for job id P28290

User Input

>input (1259 residues)
MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLP
GAQLPAAGGRGNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGA
EANHLHESDAQIENCNNILAKERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDP
EEILYNLGFGRDEPDIASKIPSRFFNSSSFAKGIDIKVFLSAQMQRMEVENPNYALTSRF
RQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKETDPPPPLTRSNTANRLMKTLS
KLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKKESSSMLATVK
EEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD
FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAP
HVPATYQLGLTKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSC
DSETTVTSLGEDLATPTAQDQPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCN
TIENTGTKQSTCSPGDHIIEITEVEEDLFPAETVELLREASAESDVGKSSESEFTQYTTH
HILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQMKVCSLSNQRMGRSLLKSKDL
LKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPSFTYKYTPEEE
QELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS
QSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRV
CSVNPPSAIEMQLRRVLHDIRNSLQNLSQYPMMRGPDPAAAPYSTQKSSVLPLYENTFQE
LQVMRRSLNLFRTQMMDLELAMLRQQTMVYHHMTEEERFEVDQLQGLRNSVRMELQDLEL
QLEERLLGLEEQLRAVRMPSPFRSSALMGMCGSRSADNLSCPSPLNVMEPVTELMQEQSY
LKSELGLGLGEMGFEIPPGESSESVFSQATSESSSVCSGPSHANRRTGVPSTASVGKSKT
PLVARKKVFRASVALTPTAPSRTGSVQTPPDLESSEEVDAAEGAPEVVGPKSEVEEGHGK
LPSMPAAEEMHKNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASNSKQDYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PHV5	0.160	0.160	0.000	1237	0.980	0.998	E9PHV5.pdb.gz	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
2	AFDB:P28290	1.000	1.000	0.000	1259	1.000	1.000	P28290.pdb.gz	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
3	AFDB:P32634	0.048	0.042	9.103E-5	1753	0.136	0.098	P32634.pdb.gz	PMD1_YEAST Negative regulator of sporulation PMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMD1 PE=1 SV=1
4	AFDB:O88466	0.042	0.030	8.600E-4	1888	0.144	0.096	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
5	AFDB:Q8BI84	0.043	0.032	1.532E-3	1930	0.138	0.090	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
6	AFDB:Q7RTP6	0.044	0.031	3.528E-3	2002	0.153	0.096	Q7RTP6.pdb.gz	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
7	AFDB:Q7KMH9	0.038	0.035	3.762E-3	1420	0.134	0.119	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
8	AFDB:O54826	0.045	0.050	5.529E-3	1068	0.123	0.145	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
9	AFDB:H2KYH3	0.036	0.028	6.286E-3	2476	0.164	0.084	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
10	AFDB:Q641Q2	0.037	0.035	7.146E-3	1341	0.128	0.120	Q641Q2.pdb.gz	WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3
11	PDB:7z37DP1	0.048	0.166	1.738E-1	273	0.020	0.092	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
12	PDB:7myoB	0.066	0.247	2.903E-1	286	0.021	0.094	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
13	PDB:8dcxB	0.069	0.280	4.002E-1	236	0.021	0.114	8dcxB.pdb.gz
14	PDB:5nikD	0.067	0.212	1.117	340	0.016	0.059	5nikD.pdb.gz
15	PDB:6yxyBL	0.043	0.123	1.642	259	0.025	0.124	6yxyBL.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:7ungB0	0.045	0.214	1.750	193	0.023	0.150	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:4v8mBT	0.046	0.223	3.325	199	0.018	0.116	4v8mBT.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:7u7nD	0.047	0.246	3.325	191	0.018	0.120	7u7nD.pdb.gz
19	PDB:3frtB	0.067	0.543	3.546	142	0.007	0.063	3frtB.pdb.gz
20	PDB:4v6wCR	0.036	0.204	3.546	203	0.018	0.113	4v6wCR.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EUL7	0.0	1574	768	0.607	0.995	E7EUL7_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
2	E9PHV5	0.0	2525	1237	0.983	1.000	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
3	P28290	0.0	2585	1259	1.000	1.000	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
4	A2RU30	4.12e-38	152	521	0.084	0.203	TESP1_HUMAN Protein TESPA1 OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=2
5	Q3U132	1.37e-35	144	458	0.077	0.212	TESP1_MOUSE Protein TESPA1 OS=Mus musculus OX=10090 GN=Tespa1 PE=1 SV=1
6	E9PPW8	3.09e-17	80.5	100	0.029	0.360	E9PPW8_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
7	E9PM24	4.30e-17	79.3	80	0.028	0.438	E9PM24_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
8	F8VXJ2	0.33	36.6	187	0.017	0.118	F8VXJ2_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
9	J3KP55	0.51	35.8	171	0.017	0.129	J3KP55_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
10	Q64317	0.68	35.8	255	0.017	0.086	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1
11	P56177	0.72	35.8	255	0.017	0.086	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
12	X5D2F9	0.72	35.8	255	0.017	0.086	X5D2F9_HUMAN Distal-less homeobox 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=2 SV=1
13	Q70IV5	3.6	34.3	1561	0.026	0.021	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14722 KRAP_IP3R_bind	1.6e-53	191.9	Ki-ras-induced actin-interacting protein-IP3R-interacting domain
2	PF14723 SSFA2_C	3.1e-90	311.9	Sperm-specific antigen 2 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388731

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378912	0.834	Protein cordon-bleu
2	9606.ENSP00000264033	0.678	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000400892	0.673	Protein TESPA1
4	9606.ENSP00000306997	0.642	Myozenin-2
5	9606.ENSP00000359782	0.621	BEN domain-containing protein 6
6	9606.ENSP00000378712	0.621	Izumo sperm-egg fusion protein 4
7	9606.ENSP00000365891	0.607	Wiskott-Aldrich syndrome protein
8	9606.ENSP00000258991	0.600	Testis-expressed protein 2
9	9606.ENSP00000337804	0.552	Sperm-associated antigen 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048522	0.845	positive regulation of cellular process
GO:0048583	0.844	regulation of response to stimulus
GO:0032502	0.566	developmental process
GO:0048856	0.549	anatomical structure development
GO:0009966	0.523	regulation of signal transduction
GO:0071840	0.507	cellular component organization or biogenesis
GO:0016043	0.491	cellular component organization
GO:0032501	0.406	multicellular organismal process
GO:0048584	0.377	positive regulation of response to stimulus
GO:0048519	0.367	negative regulation of biological process
GO:0048523	0.324	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0012505	0.314	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]