StarFunc result for job id P28331

User Input

>input (727 residues)
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA
LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7qsoG	0.955	0.992	0.000	700	0.938	0.974	7qsoG.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
2	AFDB:E5KRK5	0.977	0.977	0.000	727	1.000	1.000	E5KRK5.pdb.gz	E5KRK5_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=3 SV=1
3	AFDB:Q9N4Y8	0.932	0.929	0.000	729	0.569	0.568	Q9N4Y8.pdb.gz	Q9N4Y8_CAEEL NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-5 PE=1 SV=1
4	AFDB:Q9FGI6	0.902	0.877	2.754E-94	748	0.527	0.512	Q9FGI6.pdb.gz	NDUS1_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1467 PE=1 SV=2
5	AFDB:A0A1D8PU51	0.907	0.915	7.885E-93	720	0.525	0.531	A0A1D8PU51.pdb.gz	A0A1D8PU51_CANAL NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR10140WA PE=3 SV=1
6	PDB:7a23C	0.888	0.931	1.249E-81	693	0.517	0.543	7a23C.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
7	AFDB:P9WIV9	0.803	0.727	2.055E-52	806	0.275	0.248	P9WIV9.pdb.gz	NUOG_MYCTU NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoG PE=1 SV=1
8	AFDB:Q74FU6	0.787	0.683	9.232E-48	844	0.248	0.213	Q74FU6.pdb.gz	SFRA_GEOSL NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=sfrA PE=1 SV=1
9	AFDB:P33602	0.753	0.610	4.680E-47	908	0.223	0.178	P33602.pdb.gz	NUOG_ECOLI NADH-quinone oxidoreductase subunit G OS=Escherichia coli (strain K12) OX=83333 GN=nuoG PE=1 SV=4
10	PDB:7awtG	0.742	0.602	1.671E-44	907	0.226	0.181	7awtG.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
11	AFDB:Q388Y9	0.280	0.664	1.828E-23	303	0.122	0.294	Q388Y9.pdb.gz	Q388Y9_TRYB2 Electron transfer protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1140 PE=4 SV=1
12	AFDB:P06131	0.481	0.509	1.032E-22	684	0.129	0.137	P06131.pdb.gz	FDHA_METFO Formate dehydrogenase subunit alpha OS=Methanobacterium formicicum OX=2162 GN=fdhA PE=1 SV=1
13	PDB:1fdiA	0.513	0.521	5.223E-19	715	0.120	0.122	1fdiA.pdb.gz	Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
14	AFDB:P39458	0.474	0.473	3.943E-18	729	0.114	0.114	P39458.pdb.gz	NARB_SYNE7 Nitrate reductase OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=narB PE=1 SV=2
15	PDB:2nyaA	0.442	0.408	4.056E-16	791	0.109	0.100	2nyaA.pdb.gz	Spectropotentiometric and structural analysis of the periplasmic nitrate reductase from Escherichia coli
16	PDB:6sdvA	0.410	0.314	3.227E-12	967	0.103	0.078	6sdvA.pdb.gz	Towards the mechanistic understanding of enzymatic CO2 reduction
17	PDB:2e7zA	0.378	0.378	1.587E-10	727	0.088	0.088	2e7zA.pdb.gz	Structure of the non-redox-active tungsten/[4Fe:4S] enzyme acetylene hydratase
18	PDB:7b04B	0.351	0.240	1.341E-8	1120	0.113	0.073	7b04B.pdb.gz	Structural and functional characterization of the intracellular filament-forming nitrite oxidoreductase multiprotein complex
19	PDB:3egwA	0.384	0.236	4.913E-8	1244	0.095	0.055	3egwA.pdb.gz	When width is more important than height: Barriers to electron transfer in E.coli nitrate reductase
20	PDB:3ax7A	0.101	0.067	6.876E-3	1225	0.089	0.053	3ax7A.pdb.gz	Protein conformational gating of enzymatic activity in xanthine oxidoreductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PU51	0.0	782	720	0.532	0.537	A0A1D8PU51_CANAL NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR10140WA PE=3 SV=1
2	B4DJ81	0.0	1266	611	0.840	1.000	B4DJ81_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=1
3	E5KRK5	0.0	1506	727	1.000	1.000	E5KRK5_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=3 SV=1
4	P15690	0.0	1477	727	0.974	0.974	NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS1 PE=1 SV=1
5	P28331	0.0	1506	727	1.000	1.000	NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=3
6	Q91VD9	0.0	1434	727	0.941	0.941	NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs1 PE=1 SV=2
7	Q9FGI6	0.0	753	748	0.514	0.500	NDUS1_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1467 PE=1 SV=2
8	Q9N4Y8	0.0	866	729	0.576	0.575	Q9N4Y8_CAEEL NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-5 PE=1 SV=1
9	P9WIV9	3.63e-69	244	806	0.228	0.206	NUOG_MYCTU NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoG PE=1 SV=1
10	P33602	8.16e-58	213	908	0.246	0.197	NUOG_ECOLI NADH-quinone oxidoreductase subunit G OS=Escherichia coli (strain K12) OX=83333 GN=nuoG PE=1 SV=4
11	Q74FU6	6.60e-54	201	844	0.176	0.152	SFRA_GEOSL NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=sfrA PE=1 SV=1
12	Q388Y9	4.58e-49	176	303	0.114	0.274	Q388Y9_TRYB2 Electron transfer protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1140 PE=4 SV=1
13	Q46508	1.25e-26	117	585	0.096	0.120	HNDD_SOLFR NADP-reducing hydrogenase subunit HndD OS=Solidesulfovibrio fructosivorans OX=878 GN=hndD PE=1 SV=1
14	P06131	4.44e-07	55.8	684	0.059	0.063	FDHA_METFO Formate dehydrogenase subunit alpha OS=Methanobacterium formicicum OX=2162 GN=fdhA PE=1 SV=1
15	P39458	8.11e-04	45.1	729	0.041	0.041	NARB_SYNE7 Nitrate reductase OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=narB PE=1 SV=2
16	P33937	0.004	43.1	828	0.033	0.029	NAPA_ECOLI Periplasmic nitrate reductase OS=Escherichia coli (strain K12) OX=83333 GN=napA PE=1 SV=3
17	P07658	0.012	41.6	715	0.033	0.034	FDHF_ECOLI Formate dehydrogenase H OS=Escherichia coli (strain K12) OX=83333 GN=fdhF PE=1 SV=2
18	O88111	0.13	38.1	831	0.029	0.025	O88111_CERSP Periplasmic nitrate reductase OS=Cereibacter sphaeroides f. sp. denitrificans OX=39723 GN=napA PE=3 SV=1
19	Q5I6E8	0.15	37.7	494	0.048	0.071	Q5I6E8_SOLLC non-specific serine/threonine protein kinase OS=Solanum lycopersicum OX=4081 GN=Pdk1 PE=1 SV=1
20	Q71EW5	0.34	36.6	730	0.036	0.036	AHY_SYNAC Acetylene hydratase OS=Syntrophotalea acetylenica OX=29542 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00111 Fer2	6.5e-06	37.3	2Fe-2S iron-sulfur cluster binding domain
2	PF13510 Fer2_4	2.2e-14	64.6	2Fe-2S iron-sulfur cluster binding domain
3	PF00384 Molybdopterin	2.5e-72	255.9	Molybdopterin oxidoreductase
4	PF10588 NADH-G_4Fe-4S_3	1.9e-13	61.0	NADH-ubiquinone oxidoreductase-G iron-sulfur binding region
5	PF09326 NADH_dhqG_C	4e-13	61.2	NADH-ubiquinone oxidoreductase subunit G, C-terminal
6	PF00205 TPP_enzyme_M	31	15.8	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
10	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
11	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
12	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
13	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
14	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
15	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
16	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
17	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
18	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
19	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
20	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008137	0.999	NADH dehydrogenase (ubiquinone) activity
GO:0051536	0.462	iron-sulfur cluster binding
GO:0051537	0.396	2 iron, 2 sulfur cluster binding
GO:0097159	0.349	organic cyclic compound binding
GO:1901363	0.340	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032981	0.998	mitochondrial respiratory chain complex I assembly
GO:0008152	0.967	metabolic process
GO:0044237	0.960	cellular metabolic process
GO:0045333	0.712	cellular respiration
GO:0009060	0.657	aerobic respiration
GO:0071704	0.451	organic substance metabolic process
GO:0006119	0.448	oxidative phosphorylation
GO:0044238	0.444	primary metabolic process
GO:0006807	0.392	nitrogen compound metabolic process
GO:0022904	0.362	respiratory electron transport chain
GO:0042773	0.337	ATP synthesis coupled electron transport
GO:0042775	0.326	mitochondrial ATP synthesis coupled electron transport
GO:1901564	0.303	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.992	membrane
GO:0032991	0.987	protein-containing complex
GO:0031090	0.971	organelle membrane
GO:0031967	0.955	organelle envelope
GO:0005740	0.953	mitochondrial envelope
GO:0019866	0.910	organelle inner membrane
GO:0031966	0.908	mitochondrial membrane
GO:1902494	0.906	catalytic complex
GO:0005743	0.904	mitochondrial inner membrane
GO:0070013	0.891	intracellular organelle lumen
GO:1990351	0.876	transporter complex
GO:1990204	0.876	oxidoreductase complex
GO:0098798	0.873	mitochondrial protein-containing complex
GO:0098796	0.870	membrane protein complex
GO:1902495	0.836	transmembrane transporter complex
GO:0098800	0.823	inner mitochondrial membrane protein complex
GO:0098803	0.815	respiratory chain complex
GO:0005746	0.782	mitochondrial respirasome
GO:0030964	0.778	NADH dehydrogenase complex
GO:0045271	0.738	respiratory chain complex I
GO:0005747	0.651	mitochondrial respiratory chain complex I
GO:0005759	0.572	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	0.999	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.999	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]