StarFunc result for job id P28335

User Input

>input (458 residues)
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08909	0.755	0.752	2.908E-49	460	0.906	0.902	P08909.pdb.gz	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
2	AFDB:P14842	0.671	0.652	2.535E-31	471	0.476	0.463	P14842.pdb.gz	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
3	AFDB:O46635	0.655	0.638	4.072E-31	470	0.483	0.470	O46635.pdb.gz	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
4	AFDB:P41595	0.659	0.628	3.156E-29	481	0.445	0.424	P41595.pdb.gz	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
5	AFDB:Q50DZ8	0.646	0.680	3.295E-29	434	0.428	0.452	Q50DZ8.pdb.gz	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
6	AFDB:P30994	0.634	0.608	8.501E-29	479	0.421	0.403	P30994.pdb.gz	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
7	AFDB:Q02152	0.651	0.624	1.308E-28	479	0.410	0.392	Q02152.pdb.gz	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
8	AFDB:Q8UUG8	0.643	0.625	2.012E-28	471	0.441	0.429	Q8UUG8.pdb.gz	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
9	AFDB:O17470	0.626	0.424	2.044E-20	683	0.286	0.192	O17470.pdb.gz	O17470_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
10	AFDB:Q24563	0.636	0.545	2.092E-19	539	0.282	0.239	Q24563.pdb.gz	DOPR2_DROME Dopamine receptor 2 OS=Drosophila melanogaster OX=7227 GN=Dop1R2 PE=2 SV=1
11	PDB:7e32R	0.510	0.799	1.907E-16	285	0.221	0.354	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
12	PDB:7cmuR	0.538	0.884	1.164E-15	272	0.225	0.379	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
13	PDB:3pblA	0.549	0.581	1.216E-15	432	0.247	0.262	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
14	PDB:6iblA	0.524	0.600	1.508E-15	397	0.225	0.259	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
15	PDB:7e33R	0.490	0.846	3.004E-15	257	0.216	0.385	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
16	PDB:7jvrR	0.540	0.897	3.418E-15	269	0.234	0.398	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7xt8R	0.516	0.779	1.416E-14	294	0.234	0.364	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
18	PDB:7jvqR	0.522	0.810	2.946E-14	286	0.201	0.322	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:7xtbR	0.529	0.843	4.532E-14	278	0.210	0.345	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:4ldeA	0.486	0.490	6.126E-14	454	0.205	0.207	4ldeA.pdb.gz	Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08909	0.0	803	460	0.900	0.896	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
2	P28335	0.0	934	458	0.998	0.998	5HT2C_HUMAN 5-hydroxytryptamine receptor 2C OS=Homo sapiens OX=9606 GN=HTR2C PE=1 SV=2
3	P34968	0.0	805	459	0.897	0.895	5HT2C_MOUSE 5-hydroxytryptamine receptor 2C OS=Mus musculus OX=10090 GN=Htr2c PE=1 SV=2
4	P35363	2.04e-151	441	471	0.504	0.490	5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus OX=10090 GN=Htr2a PE=1 SV=1
5	P28223	2.98e-151	440	471	0.493	0.480	5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens OX=9606 GN=HTR2A PE=1 SV=2
6	P14842	2.99e-150	437	471	0.487	0.473	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
7	O46635	1.55e-149	436	470	0.493	0.481	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
8	Q8UUG8	8.04e-125	373	471	0.415	0.403	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
9	Q50DZ8	3.34e-122	365	434	0.421	0.445	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
10	P41595	7.11e-122	365	481	0.404	0.385	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
11	P30994	1.47e-119	359	479	0.406	0.388	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
12	Q02152	1.49e-118	357	479	0.402	0.384	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
13	G1NQ48	6.50e-69	223	308	0.240	0.357	G1NQ48_MELGA 5-hydroxytryptamine receptor 2A OS=Meleagris gallopavo OX=9103 PE=3 SV=2
14	G5ECV2	6.06e-56	198	635	0.269	0.194	G5ECV2_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
15	O17470	1.77e-55	197	683	0.269	0.180	O17470_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
16	G3MWM5	5.47e-55	190	414	0.286	0.316	G3MWM5_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=1
17	P30939	7.78e-54	186	366	0.260	0.325	5HT1F_HUMAN 5-hydroxytryptamine receptor 1F OS=Homo sapiens OX=9606 GN=HTR1F PE=1 SV=1
18	A0A060X727	2.46e-51	180	388	0.260	0.307	A0A060X727_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020782001 PE=3 SV=1
19	G3M4F8	5.26e-51	179	395	0.275	0.319	OCTB2_CHISP Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1
20	A0A060YJS0	5.40e-51	178	351	0.264	0.345	A0A060YJS0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00031345001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.1e-63	226.6	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.0044	28.4	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	2.5e-12	58.3	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10328 7TM_GPCR_Srx	1.3	20.1	Serpentine type 7TM GPCR chemoreceptor Srx
5	PF07136 DUF1385	46	14.8	Protein of unknown function (DUF1385)
6	PF05313 Pox_P21	7.8e+02	11.0	Poxvirus P21 membrane protein
7	PF03699 UPF0182	43	13.7	Uncharacterised protein family (UPF0182)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038211

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000049267	0.952	Guanine nucleotide binding protein (G protein), q polypeptide
2	9598.ENSPTRP00000009967	0.896	Uncharacterized protein
3	9598.ENSPTRP00000022266	0.868	Uncharacterized protein
4	9598.ENSPTRP00000014687	0.866	Arrestin, beta 2
5	9598.ENSPTRP00000046489	0.830	Multiple PDZ domain protein
6	9598.ENSPTRP00000025959	0.818	Voltage-dependent L-type calcium channel subunit alpha
7	9598.ENSPTRP00000007742	0.816	Voltage-dependent L-type calcium channel subunit alpha
8	9598.ENSPTRP00000003055	0.813	Voltage-dependent L-type calcium channel subunit alpha
9	9598.ENSPTRP00000043134	0.794	Arrestin, beta 1
10	9598.ENSPTRP00000029722	0.766	Adrenergic, beta-2-, receptor, surface
11	9598.ENSPTRP00000059419	0.743	GNAS complex locus
12	9598.ENSPTRP00000014780	0.723	Uncharacterized protein
13	9598.ENSPTRP00000006793	0.714	Adrenergic, beta, receptor kinase 1
14	9598.ENSPTRP00000037796	0.700	Arrestin 3, retinal (X-arrestin)
15	9598.ENSPTRP00000035965	0.694	Guanine nucleotide binding protein (G protein), alpha 14
16	9598.ENSPTRP00000006519	0.693	Muscarinic acetylcholine receptor
17	9598.ENSPTRP00000057372	0.686	Chemokine (C-X-C motif) ligand 12
18	9598.ENSPTRP00000015294	0.675	Transporter
19	9598.ENSPTRP00000023138	0.668	Bladder cancer associated protein
20	9598.ENSPTRP00000029870	0.667	Adrenoceptor alpha 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004993	1.000	G protein-coupled serotonin receptor activity
GO:0005488	0.998	binding
GO:0005515	0.991	protein binding
GO:0097159	0.489	organic cyclic compound binding
GO:0005102	0.341	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007210	0.990	serotonin receptor signaling pathway
GO:0007200	0.977	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0032501	0.972	multicellular organismal process
GO:0048518	0.917	positive regulation of biological process
GO:0048519	0.866	negative regulation of biological process
GO:0032879	0.810	regulation of localization
GO:0048522	0.776	positive regulation of cellular process
GO:0065008	0.770	regulation of biological quality
GO:0007631	0.763	feeding behavior
GO:0010646	0.751	regulation of cell communication
GO:0023051	0.691	regulation of signaling
GO:0051179	0.545	localization
GO:0051234	0.522	establishment of localization
GO:0006810	0.489	transport
GO:0048523	0.415	negative regulation of cellular process
GO:0007267	0.401	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.982	protein-containing complex
GO:0005737	0.724	cytoplasm
GO:0043226	0.489	organelle
GO:0043227	0.442	membrane-bounded organelle
GO:0043229	0.420	intracellular organelle
GO:0043235	0.375	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]