StarFunc result for job id P28340

User Input

>input (1107 residues)
MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQS
VLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRG
SVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEHMGDLQRELNLAISRDSRGGR
ELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPP
EGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPC
APILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPF
LGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTG
VPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIAT
LDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQIL
ENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAAD
WVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLV
ANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH
VELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLS
HQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFY
MRKKVRKDLEDQEQLLRRFGPPGPEAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6s1mA	0.848	0.925	0.000	1010	0.904	0.991	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
2	PDB:7kc0A	0.843	0.926	0.000	1004	0.461	0.508	7kc0A.pdb.gz	Structure of eukaryotic DNA polymerase delta bound to the PCNA clamp while encircling DNA.
3	AFDB:A0A024R4F4	0.931	0.931	0.000	1107	1.000	1.000	A0A024R4F4.pdb.gz
4	AFDB:A0A087WYJ2	0.885	0.904	0.000	1083	0.977	0.999	A0A087WYJ2.pdb.gz	A0A087WYJ2_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=1
5	AFDB:B3DKJ9	0.918	0.920	0.000	1105	0.691	0.692	B3DKJ9.pdb.gz
6	AFDB:M0R2B7	0.915	0.895	0.000	1133	1.000	0.977	M0R2B7.pdb.gz	M0R2B7_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=1
7	AFDB:P15436	0.854	0.861	0.000	1097	0.473	0.478	P15436.pdb.gz	DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL3 PE=1 SV=4
8	AFDB:P30315	0.867	0.877	0.000	1094	0.411	0.416	P30315.pdb.gz	DPOD_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) OX=5839 GN=POLD PE=1 SV=1
9	AFDB:P30316	0.881	0.897	0.000	1086	0.526	0.536	P30316.pdb.gz	DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol3 PE=1 SV=2
10	AFDB:P46588	0.874	0.931	0.000	1038	0.515	0.549	P46588.pdb.gz	DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans OX=5476 GN=POL3 PE=3 SV=2
11	AFDB:P52431	0.936	0.938	0.000	1105	0.895	0.897	P52431.pdb.gz	DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus OX=10090 GN=Pold1 PE=1 SV=2
12	AFDB:P54358	0.905	0.917	0.000	1092	0.585	0.593	P54358.pdb.gz	DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PolD1 PE=1 SV=2
13	PDB:7lufB	0.726	0.760	6.399E-59	1054	0.235	0.247	7lufB.pdb.gz	Structural understanding of non-nucleoside inhibition in an elongating herpesvirus polymerase.
14	PDB:6v93A	0.728	0.644	3.273E-54	1259	0.232	0.204	6v93A.pdb.gz	Structure and mechanism of B-family DNA polymerase zeta specialized for translesion DNA synthesis.
15	PDB:3k57A	0.606	0.842	4.379E-40	782	0.170	0.240	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
16	PDB:7lxdA	0.687	0.642	3.891E-36	1190	0.216	0.201	7lxdA.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
17	PDB:3k5nA	0.569	0.808	6.027E-36	759	0.167	0.244	3k5nA.pdb.gz	Structural insight into translesion synthesis by DNA Pol II.
18	PDB:8d0kF	0.485	0.578	1.207E-33	915	0.173	0.209	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
19	PDB:2oyqA	0.555	0.712	5.355E-32	848	0.140	0.183	2oyqA.pdb.gz	Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.
20	PDB:3cfoA	0.536	0.645	1.487E-31	906	0.137	0.168	3cfoA.pdb.gz	Structure of the replication complex of a POL Alpha family DNA Polymerase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYJ2	0.0	2207	1083	0.978	1.000	A0A087WYJ2_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=1
2	M0R2B7	0.0	2255	1133	1.000	0.977	M0R2B7_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=1
3	O54747	0.0	2050	1103	0.899	0.902	DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus OX=10116 GN=Pold1 PE=2 SV=1
4	P15436	0.0	1037	1097	0.474	0.479	DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL3 PE=1 SV=4
5	P28339	0.0	2068	1106	0.941	0.942	DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus OX=9913 GN=POLD1 PE=1 SV=1
6	P28340	0.0	2270	1107	1.000	1.000	DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2
7	P30315	0.0	909	1094	0.406	0.410	DPOD_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) OX=5839 GN=POLD PE=1 SV=1
8	P30316	0.0	1191	1086	0.516	0.526	DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol3 PE=1 SV=2
9	P46588	0.0	1118	1038	0.510	0.544	DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans OX=5476 GN=POL3 PE=3 SV=2
10	P52431	0.0	2041	1105	0.895	0.897	DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus OX=10090 GN=Pold1 PE=1 SV=2
11	P54358	0.0	1321	1092	0.593	0.601	DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PolD1 PE=1 SV=2
12	Q2KNE0	0.0	1618	1105	0.697	0.699	Q2KNE0_DANRE DNA polymerase OS=Danio rerio OX=7955 GN=zgc:152688 PE=1 SV=1
13	Q585S7	0.0	990	1026	0.472	0.510	Q585S7_TRYB2 DNA polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.40 PE=3 SV=1
14	P03198	2.81e-121	400	1015	0.266	0.290	DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BALF5 PE=1 SV=1
15	Q2HRD0	1.50e-117	389	1012	0.264	0.289	DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=ORF9 PE=3 SV=1
16	Q61493	7.57e-91	324	3122	0.222	0.079	REV3L_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus OX=10090 GN=Rev3l PE=1 SV=3
17	O60673	4.72e-90	321	3130	0.222	0.079	REV3L_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2
18	F4HTM5	2.71e-85	306	1915	0.217	0.125	F4HTM5_ARATH DNA polymerase OS=Arabidopsis thaliana OX=3702 GN=REV3 PE=1 SV=2
19	Q766Z3	2.95e-85	306	1890	0.217	0.127	REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=REV3 PE=2 SV=1
20	Q9P6L6	2.66e-84	302	1480	0.211	0.158	DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rev3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00136 DNA_pol_B	2.4e-139	476.6	DNA polymerase family B
2	PF03175 DNA_pol_B_2	77	13.6	DNA polymerase type B, organellar and viral
3	PF03104 DNA_pol_B_exo1	1e-80	283.1	DNA polymerase family B, exonuclease domain
4	PF14260 zf-C4pol	3.7e-16	70.6	C4-type zinc-finger of DNA polymerase delta

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263681	0.999	DNA polymerase delta subunit 3
2	9606.ENSP00000311368	0.999	DNA polymerase delta subunit 4
3	9606.ENSP00000322570	0.999	DNA polymerase epsilon catalytic subunit A
4	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
5	9606.ENSP00000480186	0.999	DNA polymerase delta subunit 2
6	9606.ENSP00000233146	0.998	DNA mismatch repair protein Msh2
7	9606.ENSP00000234420	0.998	DNA mismatch repair protein Msh6
8	9606.ENSP00000305480	0.998	Flap endonuclease 1
9	9606.ENSP00000254719	0.997	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000265465	0.997	DNA polymerase alpha subunit B
11	9606.ENSP00000216367	0.995	DNA polymerase epsilon subunit 2
12	9606.ENSP00000480987	0.994	DNA replication licensing factor MCM3
13	9606.ENSP00000412698	0.991	MMS19 nucleotide excision repair protein homolog
14	9606.ENSP00000263274	0.990	DNA ligase 1
15	9606.ENSP00000355506	0.990	Exonuclease 1
16	9606.ENSP00000368349	0.990	DNA polymerase alpha catalytic subunit
17	9606.ENSP00000372088	0.988	DNA repair protein RAD51 homolog 1
18	9606.ENSP00000223129	0.987	Replication protein A 14 kDa subunit
19	9606.ENSP00000363017	0.986	Replication protein A 32 kDa subunit
20	9606.ENSP00000265056	0.984	DNA replication licensing factor MCM2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003887	1.000	DNA-directed DNA polymerase activity
GO:0003676	0.998	nucleic acid binding
GO:0004527	0.965	exonuclease activity
GO:0003677	0.907	DNA binding
GO:0008408	0.897	3'-5' exonuclease activity
GO:0003684	0.824	damaged DNA binding
GO:0003682	0.708	chromatin binding
GO:0019899	0.641	enzyme binding
GO:0004536	0.569	deoxyribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0006259	0.990	DNA metabolic process
GO:0071897	0.970	DNA biosynthetic process
GO:0050896	0.905	response to stimulus
GO:0006974	0.885	cellular response to DNA damage stimulus
GO:0006281	0.879	DNA repair
GO:0006260	0.748	DNA replication
GO:0006261	0.380	DNA-templated DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005737	0.997	cytoplasm
GO:0005694	0.996	chromosome
GO:0140535	0.994	intracellular protein-containing complex
GO:1990234	0.992	transferase complex
GO:0140513	0.990	nuclear protein-containing complex
GO:0005829	0.988	cytosol
GO:0000228	0.978	nuclear chromosome
GO:0032993	0.977	protein-DNA complex
GO:0061695	0.974	transferase complex, transferring phosphorus-containing groups
GO:0043596	0.965	nuclear replication fork
GO:0043625	0.961	delta DNA polymerase complex
GO:0016234	0.918	inclusion body
GO:0016235	0.914	aggresome
GO:0098687	0.616	chromosomal region
GO:0016020	0.511	membrane
GO:0000781	0.328	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.7	1.000	DNA-directed DNA polymerase.
EC:3.1.-.-	0.972	Acting on ester bonds.

[back to server]