StarFunc result for job id P28347

User Input

>input (426 residues)
MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQ
HMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAY
PIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFV
HIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCE
YMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI
YRLVKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0YE88	0.628	0.628	3.026E-81	426	0.998	0.998	H0YE88.pdb.gz	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
2	AFDB:F1QLL3	0.636	0.642	3.845E-74	422	0.845	0.853	F1QLL3.pdb.gz
3	AFDB:Q3USK5	0.551	0.539	1.962E-73	436	0.958	0.936	Q3USK5.pdb.gz	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
4	AFDB:Q15561	0.738	0.725	9.633E-70	434	0.758	0.744	Q15561.pdb.gz	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
5	AFDB:P70210	0.529	0.513	7.487E-64	439	0.716	0.695	P70210.pdb.gz	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
6	AFDB:A0A024QZE2	0.557	0.528	6.973E-60	450	0.674	0.638	A0A024QZE2.pdb.gz
7	AFDB:H0YEJ9	0.475	0.546	7.344E-58	368	0.859	0.995	H0YEJ9.pdb.gz	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
8	AFDB:P30052	0.523	0.506	3.293E-53	440	0.589	0.570	P30052.pdb.gz	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
9	AFDB:Q19849	0.460	0.405	1.209E-40	486	0.411	0.360	Q19849.pdb.gz	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
10	AFDB:A0A0S2Z4E5	0.447	0.797	4.295E-36	238	0.469	0.840	A0A0S2Z4E5.pdb.gz	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
11	PDB:5nalB	0.218	0.539	6.992E-5	150	0.049	0.140	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
12	PDB:4f38B	0.193	0.375	1.775E-4	192	0.047	0.104	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
13	PDB:4gojC	0.229	0.514	2.827E-4	161	0.042	0.112	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
14	PDB:7tvzE	0.125	0.089	7.805E-3	665	0.066	0.042	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
15	PDB:1l9mB	0.165	0.113	1.481E-2	681	0.063	0.040	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
16	PDB:3t6qC	0.139	0.346	1.981E-2	139	0.023	0.072	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:5ijdC	0.129	0.314	2.100E-2	137	0.023	0.073	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
18	PDB:2hkaB	0.146	0.388	2.500E-2	130	0.033	0.108	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
19	PDB:5kwyC	0.141	0.362	2.500E-2	133	0.023	0.075	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
20	PDB:3b2dC	0.138	0.346	3.545E-2	139	0.026	0.079	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3DUQ6	0.0	559	361	0.646	0.762	D3DUQ6_HUMAN TEA domain family member 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
2	E9PKB7	0.0	671	330	0.744	0.961	E9PKB7_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
3	H0YE88	0.0	896	426	0.998	0.998	H0YE88_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=1
4	P28347	0.0	897	426	1.000	1.000	TEAD1_HUMAN Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
5	P30051	0.0	892	426	0.993	0.993	TEAD1_MOUSE Transcriptional enhancer factor TEF-1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=2
6	P48301	0.0	514	445	0.634	0.607	TEAD2_MOUSE Transcriptional enhancer factor TEF-4 OS=Mus musculus OX=10090 GN=Tead2 PE=2 SV=1
7	P70210	0.0	609	439	0.714	0.692	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
8	Q15561	0.0	651	434	0.756	0.742	TEAD4_HUMAN Transcriptional enhancer factor TEF-3 OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=3
9	Q15562	0.0	533	447	0.657	0.626	TEAD2_HUMAN Transcriptional enhancer factor TEF-4 OS=Homo sapiens OX=9606 GN=TEAD2 PE=1 SV=2
10	Q3USK5	0.0	847	436	0.958	0.936	Q3USK5_MOUSE TEA domain family member 1 OS=Mus musculus OX=10090 GN=Tead1 PE=1 SV=1
11	Q53GI4	0.0	651	434	0.756	0.742	Q53GI4_HUMAN TEA domain family member 4 isoform 1 variant (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
12	Q62296	0.0	655	427	0.751	0.749	TEAD4_MOUSE Transcriptional enhancer factor TEF-3 OS=Mus musculus OX=10090 GN=Tead4 PE=1 SV=2
13	Q7SXX3	0.0	704	393	0.777	0.842	Q7SXX3_DANRE TEA domain family member 1 OS=Danio rerio OX=7955 GN=tead1 PE=2 SV=1
14	Q99594	0.0	625	435	0.716	0.701	TEAD3_HUMAN Transcriptional enhancer factor TEF-5 OS=Homo sapiens OX=9606 GN=TEAD3 PE=1 SV=2
15	H0YEJ9	1.37e-171	486	368	0.547	0.633	H0YEJ9_HUMAN TEA domain transcription factor 1 OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=2
16	P30052	2.34e-167	479	440	0.599	0.580	SCAL_DROME Protein scalloped OS=Drosophila melanogaster OX=7227 GN=sd PE=1 SV=1
17	A0A0S2Z4E5	3.09e-121	353	238	0.380	0.681	A0A0S2Z4E5_HUMAN TEA domain family member 4 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
18	Q19849	3.95e-82	262	486	0.413	0.362	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
19	H0YG62	1.06e-63	205	189	0.272	0.614	H0YG62_HUMAN TEA domain transcription factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD4 PE=1 SV=1
20	H0YCZ6	3.43e-41	142	67	0.157	1.000	H0YCZ6_HUMAN TEA domain transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=TEAD1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01285 TEA	1.4e-23	94.2	TEA/ATTS domain
2	PF17725 YBD	3.7e-66	234.2	YAP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021447

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008726	0.999	Yes-associated protein 1
2	61853.ENSNLEP00000003745	0.995	WW domain containing transcription regulator 1
3	61853.ENSNLEP00000005522	0.929	Vestigial-like family member 4
4	61853.ENSNLEP00000016113	0.909	Vestigial-like family member 2
5	61853.ENSNLEP00000003436	0.841	TEA domain family member 4
6	61853.ENSNLEP00000003413	0.840	Vestigial-like family member 1
7	61853.ENSNLEP00000001724	0.832	Transcription factor 7-like 1 (T-cell specific, HMG-box)
8	61853.ENSNLEP00000009815	0.832	Transcription factor 7 (T-cell specific, HMG-box)
9	61853.ENSNLEP00000017678	0.794	Connective tissue growth factor
10	61853.ENSNLEP00000014334	0.778	Vestigial-like family member 3
11	61853.ENSNLEP00000018606	0.754	Large tumor suppressor kinase 1
12	61853.ENSNLEP00000004476	0.748	INSM transcriptional repressor 2
13	61853.ENSNLEP00000003610	0.667	Tetraspanin 9
14	61853.ENSNLEP00000019517	0.637	Malonyl-CoA-acyl carrier protein transacylase
15	61853.ENSNLEP00000002376	0.627	Large tumor suppressor kinase 2
16	61853.ENSNLEP00000017787	0.604	Angiomotin
17	61853.ENSNLEP00000012236	0.594	Cysteine-rich, angiogenic inducer, 61
18	61853.ENSNLEP00000014845	0.593	Salvador family WW domain containing protein 1
19	61853.ENSNLEP00000017864	0.592	Peripheral myelin protein 22
20	61853.ENSNLEP00000000652	0.572	Dedicator of cytokinesis 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:1990837	0.986	sequence-specific double-stranded DNA binding
GO:0000976	0.961	transcription cis-regulatory region binding
GO:0000977	0.949	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.929	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.908	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.649	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.542	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0006357	0.992	regulation of transcription by RNA polymerase II
GO:0048522	0.988	positive regulation of cellular process
GO:0009987	0.982	cellular process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:0031325	0.974	positive regulation of cellular metabolic process
GO:0050896	0.970	response to stimulus
GO:0010557	0.945	positive regulation of macromolecule biosynthetic process
GO:0031328	0.945	positive regulation of cellular biosynthetic process
GO:0045935	0.945	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.944	positive regulation of DNA-templated transcription
GO:0045944	0.928	positive regulation of transcription by RNA polymerase II
GO:0051716	0.848	cellular response to stimulus
GO:0007154	0.754	cell communication
GO:0032502	0.742	developmental process
GO:0023052	0.737	signaling
GO:0048856	0.685	anatomical structure development
GO:0007165	0.654	signal transduction
GO:0032501	0.629	multicellular organismal process
GO:0007275	0.573	multicellular organism development
GO:0035556	0.573	intracellular signal transduction
GO:0048519	0.419	negative regulation of biological process
GO:0048731	0.380	system development
GO:0048523	0.376	negative regulation of cellular process
GO:0035329	0.309	hippo signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0005737	0.803	cytoplasm
GO:0005667	0.621	transcription regulator complex
GO:0090575	0.468	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]