StarFunc result for job id P28356

User Input

>input (352 residues)
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATA
AEFASCSFAPRSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWM
EPLPGFPGGAGGGGGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSS
STSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAAATGGTGPGAGIGAATGTGGSS
EPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLEL
EKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPKGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28356	1.000	1.000	3.916E-49	352	1.000	1.000	P28356.pdb.gz	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
2	AFDB:A0A0G2JT82	0.173	0.152	2.380E-6	399	0.210	0.185	A0A0G2JT82.pdb.gz	A0A0G2JT82_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En1 PE=3 SV=2
3	AFDB:P82976	0.181	0.154	2.380E-6	418	0.239	0.201	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
4	PDB:4egcA	0.133	0.090	2.412E-2	539	0.045	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
5	AFDB:A0A1C7CYY7	0.167	0.105	9.175E-2	577	0.219	0.133	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
6	PDB:2hi3A	0.148	0.605	1.739E-1	73	0.051	0.247	2hi3A.pdb.gz
7	AFDB:Q5MD19	0.180	0.142	2.729E-1	461	0.153	0.117	Q5MD19.pdb.gz
8	AFDB:Q5VR96	0.082	0.067	5.038E-1	437	0.156	0.126	Q5VR96.pdb.gz	Q5VR96_ORYSJ Os06g0275600 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0275600 PE=3 SV=1
9	AFDB:F1RET1	0.068	0.017	5.394E-1	2248	0.156	0.024	F1RET1.pdb.gz
10	AFDB:O08755	0.173	0.133	5.394E-1	465	0.153	0.116	O08755.pdb.gz	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
11	AFDB:Q6P2H3	0.083	0.050	6.617E-1	762	0.170	0.079	Q6P2H3.pdb.gz	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
12	AFDB:Q3UHU5	0.067	0.020	7.582E-1	1945	0.216	0.039	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
13	PDB:7fbyA	0.110	0.229	1.095	153	0.023	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cjjA	0.150	0.700	1.343	63	0.040	0.222	2cjjA.pdb.gz
15	PDB:5nr5A	0.116	0.323	1.437	113	0.023	0.071	5nr5A.pdb.gz
16	PDB:2cg4A	0.103	0.212	2.654	149	0.020	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:5x6cA	0.098	0.068	2.654	539	0.026	0.017	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
18	PDB:7dvq7	0.088	0.309	2.841	81	0.040	0.173	7dvq7.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:4ldzA	0.087	0.128	3.256	196	0.040	0.071	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
20	PDB:5ds9B	0.097	0.272	3.256	98	0.023	0.082	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28356	0.0	709	352	1.000	1.000	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
2	P28357	7.62e-158	447	339	0.832	0.864	HXD9_MOUSE Homeobox protein Hox-D9 OS=Mus musculus OX=10090 GN=Hoxd9 PE=2 SV=1
3	P31274	2.40e-72	227	260	0.455	0.615	HXC9_HUMAN Homeobox protein Hox-C9 OS=Homo sapiens OX=9606 GN=HOXC9 PE=1 SV=3
4	P09633	3.47e-72	227	260	0.455	0.615	HXC9_MOUSE Homeobox protein Hox-C9 OS=Mus musculus OX=10090 GN=Hoxc9 PE=2 SV=2
5	D3ZSU5	6.93e-62	201	271	0.426	0.554	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
6	P09631	3.52e-61	199	271	0.423	0.550	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
7	P31269	5.18e-60	196	272	0.420	0.544	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
8	A0A669KBC8	1.14e-48	164	213	0.199	0.329	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
9	A0A669K9T0	3.12e-48	164	225	0.199	0.311	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
10	P20615	3.57e-45	157	250	0.190	0.268	HXB9_MOUSE Homeobox protein Hox-B9 OS=Mus musculus OX=10090 GN=Hoxb9 PE=2 SV=3
11	P17482	3.85e-45	157	250	0.190	0.268	HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2
12	Q9YGS6	1.85e-41	147	260	0.179	0.242	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
13	P28359	2.63e-36	136	340	0.193	0.200	HXD10_MOUSE Homeobox protein Hox-D10 OS=Mus musculus OX=10090 GN=Hoxd10 PE=1 SV=2
14	P28358	5.49e-36	135	340	0.193	0.200	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
15	Q53XI4	3.27e-35	133	342	0.153	0.158	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
16	Q9NYD6	3.27e-35	133	342	0.153	0.158	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
17	P31257	5.55e-35	132	342	0.153	0.158	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
18	P31310	2.10e-34	132	416	0.156	0.132	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
19	P31260	3.60e-34	132	410	0.156	0.134	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3
20	O43248	2.98e-25	105	304	0.114	0.132	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	6.2e-17	72.5	Homeodomain
2	PF04617 Hox9_act	7.6e-38	142.3	Hox9 activation region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.859	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000364190	0.820	Pre-B-cell leukemia transcription factor 2
3	9606.ENSP00000362588	0.782	Pre-B-cell leukemia transcription factor 3
4	9606.ENSP00000272369	0.681	Homeobox protein Meis1
5	9606.ENSP00000315949	0.671	Homeobox protein Hox-D8
6	9606.ENSP00000309913	0.634	T-box transcription factor TBX5
7	9606.ENSP00000249501	0.633	Homeobox protein Hox-D10
8	9606.ENSP00000274353	0.621	Betaine--homocysteine S-methyltransferase 1
9	9606.ENSP00000345347	0.608	High mobility group protein B1
10	9606.ENSP00000302548	0.576	Homeobox protein Hox-D4
11	9606.ENSP00000386498	0.573	Homeobox protein Hox-D3
12	9606.ENSP00000249504	0.572	Homeobox protein Hox-D11
13	9606.ENSP00000297261	0.557	Sonic hedgehog protein
14	9606.ENSP00000453793	0.538	Homeobox protein Meis2
15	9606.ENSP00000376322	0.537	Homeobox protein Hox-D13
16	9606.ENSP00000240335	0.505	T-box transcription factor TBX4
17	9606.ENSP00000237612	0.503	ATP-binding cassette sub-family G member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.943	protein binding
GO:0001217	0.936	DNA-binding transcription repressor activity
GO:0001227	0.929	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228	0.318	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0051252	0.918	regulation of RNA metabolic process
GO:1903506	0.906	regulation of nucleic acid-templated transcription
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0006357	0.893	regulation of transcription by RNA polymerase II
GO:0032502	0.737	developmental process
GO:0048856	0.729	anatomical structure development
GO:0032501	0.724	multicellular organismal process
GO:0048519	0.700	negative regulation of biological process
GO:0048731	0.700	system development
GO:0048523	0.656	negative regulation of cellular process
GO:0048518	0.648	positive regulation of biological process
GO:0048522	0.627	positive regulation of cellular process
GO:0010604	0.571	positive regulation of macromolecule metabolic process
GO:0051173	0.567	positive regulation of nitrogen compound metabolic process
GO:0031325	0.567	positive regulation of cellular metabolic process
GO:0009987	0.566	cellular process
GO:0045892	0.566	negative regulation of DNA-templated transcription
GO:0048513	0.528	animal organ development
GO:1903508	0.508	positive regulation of nucleic acid-templated transcription
GO:0045893	0.504	positive regulation of DNA-templated transcription
GO:0000122	0.471	negative regulation of transcription by RNA polymerase II
GO:0009653	0.378	anatomical structure morphogenesis
GO:0045944	0.364	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005730	0.447	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]