StarFunc result for job id P28360

User Input

>input (303 residues)
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLP
FSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSV
GGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFT
TAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMY
HLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13297	0.759	0.759	2.152E-40	303	0.937	0.937	P13297.pdb.gz	MSX1_MOUSE Homeobox protein MSX-1 OS=Mus musculus OX=10090 GN=Msx1 PE=1 SV=4
2	AFDB:Q03356	0.350	0.405	1.820E-17	257	0.429	0.506	Q03356.pdb.gz	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
3	AFDB:Q502Q5	0.294	0.556	1.693E-15	156	0.389	0.756	Q502Q5.pdb.gz
4	AFDB:Q99626	0.258	0.251	2.252E-10	313	0.254	0.246	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
5	AFDB:P41936	0.224	0.197	5.902E-9	346	0.241	0.211	P41936.pdb.gz	HM22_CAEEL Homeobox protein ceh-22 OS=Caenorhabditis elegans OX=6239 GN=ceh-22 PE=2 SV=1
6	AFDB:G5EE18	0.252	0.364	1.075E-8	201	0.205	0.308	G5EE18.pdb.gz	CEH28_CAEEL Homeobox protein ceh-28 OS=Caenorhabditis elegans OX=6239 GN=ceh-28 PE=2 SV=1
7	AFDB:Q18533	0.213	0.190	1.313E-8	341	0.211	0.188	Q18533.pdb.gz	HMX_CAEEL Homeobox protein mls-2 OS=Caenorhabditis elegans OX=6239 GN=mls-2 PE=1 SV=2
8	AFDB:A5WVY6	0.250	0.247	2.238E-8	307	0.224	0.221	A5WVY6.pdb.gz
9	AFDB:O14627	0.267	0.281	2.393E-8	284	0.208	0.222	O14627.pdb.gz	CDX4_HUMAN Homeobox protein CDX-4 OS=Homo sapiens OX=9606 GN=CDX4 PE=1 SV=1
10	AFDB:A0A669K9T0	0.248	0.329	4.078E-8	225	0.215	0.289	A0A669K9T0.pdb.gz	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
11	PDB:4egcA	0.167	0.094	6.263E-3	539	0.050	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.166	0.612	5.650E-2	73	0.053	0.219	2hi3A.pdb.gz
13	PDB:7fbyA	0.133	0.239	4.174E-1	153	0.033	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:6dv9F	0.102	0.165	8.128E-1	174	0.053	0.092	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
15	PDB:7w59R	0.105	0.114	9.287E-1	280	0.086	0.093	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:5aj0BZ	0.139	0.417	1.134	86	0.040	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:7awtE	0.091	0.159	1.385	156	0.020	0.038	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
18	PDB:2rvqD	0.093	0.165	1.692	129	0.056	0.132	2rvqD.pdb.gz
19	PDB:7b93E	0.104	0.143	1.933	215	0.030	0.042	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:4ldzA	0.131	0.186	2.884	196	0.033	0.051	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28360	0.0	592	303	1.000	1.000	MSX1_HUMAN Homeobox protein MSX-1 OS=Homo sapiens OX=9606 GN=MSX1 PE=1 SV=3
2	P13297	1.20e-177	494	303	0.937	0.937	MSX1_MOUSE Homeobox protein MSX-1 OS=Mus musculus OX=10090 GN=Msx1 PE=1 SV=4
3	Q9QUG0	5.35e-169	472	297	0.917	0.936	Q9QUG0_RAT Msx-1 protein OS=Rattus norvegicus OX=10116 GN=Msx1 PE=2 SV=1
4	P28361	1.09e-90	271	249	0.581	0.707	MSX1_CHICK Homeobox protein MSX-1 OS=Gallus gallus OX=9031 GN=MSX1 PE=2 SV=1
5	Q03358	2.59e-87	264	267	0.531	0.603	MSX2_MOUSE Homeobox protein MSX-2 OS=Mus musculus OX=10090 GN=Msx2 PE=1 SV=2
6	P35548	1.35e-86	262	267	0.515	0.584	MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=3
7	Q90455	2.09e-82	250	233	0.521	0.678	Q90455_DANRE Homeobox protein MSX-1 OS=Danio rerio OX=7955 GN=msxE PE=2 SV=1
8	P52953	1.75e-72	221	139	0.366	0.799	MSX2_RAT Homeobox protein MSX-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Msx2 PE=3 SV=1
9	Q03356	2.40e-63	202	257	0.416	0.490	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
10	Q01703	3.32e-59	192	273	0.419	0.465	MSXC_DANRE Homeobox protein MSH-C OS=Danio rerio OX=7955 GN=msxc PE=2 SV=1
11	P70354	1.28e-53	176	204	0.320	0.475	MSX3_MOUSE Homeobox protein MSX-3 OS=Mus musculus OX=10090 GN=Msx3 PE=1 SV=1
12	Q03372	2.79e-41	151	515	0.231	0.136	HMSH_DROME Muscle segmentation homeobox OS=Drosophila melanogaster OX=7227 GN=Dr PE=1 SV=2
13	Q09604	6.52e-39	138	225	0.208	0.280	VAB15_CAEEL Homeobox protein vab-15 OS=Caenorhabditis elegans OX=6239 GN=vab-15 PE=2 SV=1
14	A6NCS4	1.17e-19	89.4	301	0.139	0.140	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
15	Q803Z6	4.04e-19	86.7	245	0.211	0.261	Q803Z6_DANRE Bagpipe homeobox transcription factor Bapx1 OS=Danio rerio OX=7955 GN=nkx3.2 PE=2 SV=1
16	O13005	6.99e-19	84.7	193	0.175	0.275	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
17	F8VXJ2	9.80e-19	84.3	187	0.125	0.203	F8VXJ2_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
18	Q64317	2.58e-18	84.7	255	0.125	0.149	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1
19	P56177	2.61e-18	84.7	255	0.125	0.149	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
20	X5D2F9	2.61e-18	84.7	255	0.125	0.149	X5D2F9_HUMAN Distal-less homeobox 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.5e-17	74.5	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355245	0.987	Paired box protein Pax-9
2	9606.ENSP00000330074	0.975	Histone H1.5
3	9606.ENSP00000257566	0.872	T-box transcription factor TBX3
4	9606.ENSP00000239243	0.860	Homeobox protein MSX-2
5	9606.ENSP00000245451	0.857	Bone morphogenetic protein 4
6	9606.ENSP00000375942	0.856	TATA-box-binding protein
7	9606.ENSP00000273153	0.797	Cysteine/serine-rich nuclear protein 1
8	9606.ENSP00000282928	0.795	Zinc finger protein ZIC 1
9	9606.ENSP00000360157	0.790	Forkhead box protein D3
10	9606.ENSP00000362717	0.785	LIM/homeobox protein Lhx2
11	9606.ENSP00000355988	0.771	Interferon regulatory factor 6
12	9606.ENSP00000321797	0.766	Fibroblast growth factor 8
13	9606.ENSP00000249636	0.740	E3 SUMO-protein ligase PIAS1
14	9606.ENSP00000297261	0.740	Sonic hedgehog protein
15	9606.ENSP00000340226	0.737	LIM homeobox transcription factor 1-alpha
16	9606.ENSP00000380034	0.736	Zinc finger protein SNAI2
17	9606.ENSP00000245479	0.730	Transcription factor SOX-9
18	9606.ENSP00000398632	0.726	CD44 antigen
19	9606.ENSP00000380093	0.722	Transcription factor SOX-10
20	9606.ENSP00000323588	0.708	Transcription factor SOX-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.846	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.820	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001227	0.807	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.997	developmental process
GO:0032501	0.995	multicellular organismal process
GO:0007275	0.991	multicellular organism development
GO:0009987	0.988	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048513	0.978	animal organ development
GO:0048731	0.968	system development
GO:0048519	0.937	negative regulation of biological process
GO:0009653	0.900	anatomical structure morphogenesis
GO:0019222	0.889	regulation of metabolic process
GO:0048518	0.879	positive regulation of biological process
GO:0051171	0.873	regulation of nitrogen compound metabolic process
GO:0080090	0.872	regulation of primary metabolic process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0010468	0.867	regulation of gene expression
GO:0048522	0.859	positive regulation of cellular process
GO:0048523	0.850	negative regulation of cellular process
GO:0009888	0.842	tissue development
GO:0050896	0.839	response to stimulus
GO:0009887	0.833	animal organ morphogenesis
GO:0006355	0.827	regulation of DNA-templated transcription
GO:0009893	0.729	positive regulation of metabolic process
GO:0006357	0.715	regulation of transcription by RNA polymerase II
GO:0009790	0.710	embryo development
GO:0001501	0.689	skeletal system development
GO:0051173	0.686	positive regulation of nitrogen compound metabolic process
GO:0031325	0.669	positive regulation of cellular metabolic process
GO:0010604	0.661	positive regulation of macromolecule metabolic process
GO:0051716	0.641	cellular response to stimulus
GO:0007154	0.504	cell communication
GO:0048583	0.495	regulation of response to stimulus
GO:0010605	0.493	negative regulation of macromolecule metabolic process
GO:0010646	0.491	regulation of cell communication
GO:0023051	0.488	regulation of signaling
GO:0031324	0.486	negative regulation of cellular metabolic process
GO:0051172	0.484	negative regulation of nitrogen compound metabolic process
GO:0009966	0.481	regulation of signal transduction
GO:0045944	0.480	positive regulation of transcription by RNA polymerase II
GO:0007165	0.475	signal transduction
GO:0030154	0.469	cell differentiation
GO:0050793	0.466	regulation of developmental process
GO:0045892	0.425	negative regulation of DNA-templated transcription
GO:0042127	0.418	regulation of cell population proliferation
GO:0007166	0.418	cell surface receptor signaling pathway
GO:0045595	0.417	regulation of cell differentiation
GO:0007399	0.376	nervous system development
GO:0009967	0.355	positive regulation of signal transduction
GO:0051239	0.337	regulation of multicellular organismal process
GO:0071495	0.333	cellular response to endogenous stimulus
GO:0008152	0.331	metabolic process
GO:0048598	0.325	embryonic morphogenesis
GO:0072359	0.321	circulatory system development
GO:0065009	0.306	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.837	protein-containing complex
GO:0005667	0.326	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]