StarFunc result for job id P28370

User Input

>input (1054 residues)
MEQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATEKGEKKKEKN
VSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSP
LNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKG
GPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVP
KSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVF
KKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPD
VFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLS
KMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEH
IVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEE
REDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQV
DLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKL
AKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRM
DIEQSLYKFEGEDYREKQKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRP
PKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDIPNPALAQREEQKKIDGAEP
LTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA
VFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGK
NYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLI
SLIEKENMEIEERERAEKKKRATKTPMVKFSAFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5WUY4	0.627	0.637	0.000	1036	0.809	0.823	A5WUY4.pdb.gz	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
2	AFDB:B7ZLQ5	0.660	0.651	0.000	1070	0.993	0.979	B7ZLQ5.pdb.gz	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
3	AFDB:B8A552	0.633	0.644	0.000	1035	0.773	0.787	B8A552.pdb.gz	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
4	AFDB:O60264	0.591	0.592	0.000	1052	0.796	0.798	O60264.pdb.gz	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
5	AFDB:P41877	0.560	0.584	0.000	1009	0.583	0.610	P41877.pdb.gz	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
6	AFDB:Q24368	0.568	0.582	0.000	1027	0.677	0.695	Q24368.pdb.gz	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
7	AFDB:F4JY25	0.541	0.532	1.737E-91	1072	0.512	0.504	F4JY25.pdb.gz	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
8	AFDB:Q08773	0.548	0.517	7.128E-91	1120	0.476	0.448	Q08773.pdb.gz	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
9	AFDB:Q5A310	0.562	0.561	1.587E-90	1056	0.459	0.458	Q5A310.pdb.gz	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
10	AFDB:P38144	0.574	0.538	5.715E-87	1129	0.457	0.427	P38144.pdb.gz	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
11	PDB:6jylK	0.425	0.864	4.894E-47	504	0.302	0.631	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
12	PDB:6tdaS	0.398	0.527	6.754E-36	783	0.235	0.317	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
13	PDB:6g0lM	0.376	0.460	4.234E-35	855	0.245	0.302	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:6uxwA	0.406	0.540	6.192E-34	778	0.243	0.329	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
15	PDB:7epuB	0.300	0.394	1.828E-33	748	0.210	0.295	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
16	PDB:6g0lW	0.385	0.459	4.068E-33	878	0.246	0.295	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:6kw3Y	0.402	0.743	9.526E-32	548	0.232	0.447	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:6gejM	0.388	0.583	1.154E-30	688	0.194	0.298	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7oo3b	0.378	0.699	5.204E-30	534	0.167	0.330	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
20	PDB:5vvrM	0.345	0.664	9.735E-26	503	0.159	0.334	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRP6	0.0	2141	1058	0.982	0.978	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
2	A2RUY6	0.0	1642	1028	0.758	0.777	A2RUY6_DANRE SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 OS=Danio rerio OX=7955 GN=smarca5 PE=2 SV=1
3	A5WUY4	0.0	1707	1036	0.811	0.825	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
4	B7ZLQ5	0.0	2174	1070	0.993	0.979	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
5	B8A552	0.0	1642	1035	0.758	0.772	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
6	F4JAV9	0.0	984	1057	0.493	0.492	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1
7	F4JY24	0.0	982	1069	0.491	0.485	CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
8	F4JY25	0.0	982	1072	0.491	0.483	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
9	O60264	0.0	1703	1052	0.778	0.779	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
10	P28370	0.0	2185	1054	1.000	1.000	SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2
11	P38144	0.0	911	1129	0.468	0.437	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
12	P41877	0.0	1264	1009	0.594	0.620	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
13	Q08773	0.0	959	1120	0.478	0.450	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
14	Q24368	0.0	1449	1027	0.677	0.695	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
15	Q585S8	0.0	574	1160	0.268	0.243	Q585S8_TRYB2 Transcription activator, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.35 PE=4 SV=1
16	Q5A310	0.0	947	1056	0.467	0.466	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
17	Q6PGB8	0.0	2015	1046	0.953	0.960	SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus OX=10090 GN=Smarca1 PE=1 SV=1
18	Q8RWY3	0.0	988	1056	0.493	0.492	ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=4
19	Q91ZW3	0.0	1703	1051	0.778	0.780	SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus OX=10090 GN=Smarca5 PE=1 SV=1
20	F4IV99	3.42e-150	491	1724	0.306	0.187	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13892 DBINO	0.053	25.3	DNA-binding domain
2	PF00270 DEAD	0.0021	29.3	DEAD/DEAH box helicase
3	PF09110 HAND	1.7e-26	104.5	HAND
4	PF11496 HDA2-3	0.058	24.1	Class II histone deacetylase complex subunits 2 and 3
5	PF00271 Helicase_C	3.4e-16	70.9	Helicase conserved C-terminal domain
6	PF00249 Myb_DNA-binding	0.013	27.0	Myb-like DNA-binding domain
7	PF04851 ResIII	1.2e-08	46.7	Type III restriction enzyme, res subunit
8	PF09111 SLIDE	3.6e-42	154.4	SLIDE
9	PF00176 SNF2-rel_dom	6.7e-84	293.1	SNF2-related domain
10	PF13429 TPR_15	1.7e+02	13.0	Tetratricopeptide repeat
11	PF08587 UBA_2	3e+02	12.9	Ubiquitin associated domain (UBA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000011561

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000034157	0.983	Bromodomain PHD finger transcription factor
2	9544.ENSMMUP00000019759	0.960	Uncharacterized protein
3	9544.ENSMMUP00000021344	0.940	RB binding protein 7, chromatin remodeling factor
4	9544.ENSMMUP00000035371	0.938	Bromodomain adjacent to zinc finger domain 1B
5	9544.ENSMMUP00000022841	0.912	Remodeling and spacing factor 1
6	9544.ENSMMUP00000010546	0.908	Chromatin accessibility complex protein 1
7	9544.ENSMMUP00000025403	0.907	Bromodomain adjacent to zinc finger domain, 2A
8	9544.ENSMMUP00000012240	0.895	Uncharacterized protein
9	9544.ENSMMUP00000013002	0.877	Histone-binding protein RBBP4 isoform a
10	9544.ENSMMUP00000028012	0.877	Uncharacterized protein
11	9544.ENSMMUP00000036742	0.877	Uncharacterized protein
12	9544.ENSMMUP00000009409	0.866	DNA polymerase epsilon subunit 3
13	9544.ENSMMUP00000010848	0.861	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
14	9544.ENSMMUP00000008130	0.860	Bromodomain adjacent to zinc finger domain, 2B
15	9544.ENSMMUP00000019664	0.841	SPT16 homolog, facilitates chromatin remodeling subunit
16	9544.ENSMMUP00000008858	0.840	CECR2, histone acetyl-lysine reader
17	9544.ENSMMUP00000006168	0.808	Belongs to the histone H2A family.
18	9544.ENSMMUP00000008984	0.808	Belongs to the histone H2A family.
19	9544.ENSMMUP00000012160	0.802	SIN3 transcription regulator family member A
20	9544.ENSMMUP00000026770	0.773	Belongs to the acetyltransferase family. GCN5 subfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.999	ATP-dependent activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0140097	0.995	catalytic activity, acting on DNA
GO:0008094	0.994	ATP-dependent activity, acting on DNA
GO:0003677	0.991	DNA binding
GO:0140658	0.956	ATP-dependent chromatin remodeler activity
GO:0003690	0.904	double-stranded DNA binding
GO:0016887	0.898	ATP hydrolysis activity
GO:0004386	0.892	helicase activity
GO:0036094	0.805	small molecule binding
GO:1901265	0.788	nucleoside phosphate binding
GO:0000166	0.784	nucleotide binding
GO:0008134	0.774	transcription factor binding
GO:0003682	0.765	chromatin binding
GO:0043565	0.716	sequence-specific DNA binding
GO:1990837	0.607	sequence-specific double-stranded DNA binding
GO:0043167	0.566	ion binding
GO:0140297	0.497	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0009987	0.986	cellular process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0032501	0.970	multicellular organismal process
GO:0048856	0.960	anatomical structure development
GO:0007275	0.948	multicellular organism development
GO:0009889	0.935	regulation of biosynthetic process
GO:0010468	0.927	regulation of gene expression
GO:0006355	0.906	regulation of DNA-templated transcription
GO:0048518	0.886	positive regulation of biological process
GO:0071840	0.864	cellular component organization or biogenesis
GO:0016043	0.844	cellular component organization
GO:0006325	0.681	chromatin organization
GO:0048731	0.667	system development
GO:0048513	0.597	animal organ development
GO:0048522	0.591	positive regulation of cellular process
GO:0007399	0.534	nervous system development
GO:0006338	0.525	chromatin remodeling
GO:0071704	0.521	organic substance metabolic process
GO:0044238	0.496	primary metabolic process
GO:0009893	0.487	positive regulation of metabolic process
GO:0006807	0.483	nitrogen compound metabolic process
GO:0010604	0.483	positive regulation of macromolecule metabolic process
GO:0044237	0.460	cellular metabolic process
GO:0006996	0.446	organelle organization
GO:0043170	0.407	macromolecule metabolic process
GO:0050896	0.350	response to stimulus
GO:0048519	0.336	negative regulation of biological process
GO:0006357	0.335	regulation of transcription by RNA polymerase II
GO:0031325	0.332	positive regulation of cellular metabolic process
GO:0051173	0.331	positive regulation of nitrogen compound metabolic process
GO:0048523	0.307	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0032991	0.948	protein-containing complex
GO:0000785	0.848	chromatin
GO:0070603	0.631	SWI/SNF superfamily-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.898	ATP + H2O = ADP + H(+) + phosphate

[back to server]