StarFunc result for job id P28476

User Input

>input (465 residues)
MPYFTRLILFLFCLMVLVESRKPKRKRWTGQVEMPKPSHLYKKNLDVTKIRKGKPQQLLR
VDEHDFSMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASN
KSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLR
EKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA
RKKGLLKGQTGFRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28476	1.000	1.000	1.717E-86	465	1.000	1.000	P28476.pdb.gz	GBRR2_HUMAN Gamma-aminobutyric acid receptor subunit rho-2 OS=Homo sapiens OX=9606 GN=GABRR2 PE=2 SV=5
2	AFDB:P50572	0.755	0.732	2.690E-67	480	0.725	0.702	P50572.pdb.gz	GBRR1_RAT Gamma-aminobutyric acid receptor subunit rho-1 OS=Rattus norvegicus OX=10116 GN=Gabrr1 PE=1 SV=2
3	AFDB:Q5TZ16	0.781	0.779	3.286E-66	466	0.671	0.670	Q5TZ16.pdb.gz	Q5TZ16_DANRE Gamma-aminobutyric acid receptor subunit rho-1 precursor OS=Danio rerio OX=7955 GN=si:dkey-77b17.3 PE=3 SV=1
4	AFDB:P50573	0.813	0.814	3.916E-62	464	0.589	0.591	P50573.pdb.gz	GBRR3_RAT Gamma-aminobutyric acid receptor subunit rho-3 OS=Rattus norvegicus OX=10116 GN=Gabrr3 PE=1 SV=1
5	AFDB:A8MPY1	0.791	0.788	5.361E-61	467	0.589	0.587	A8MPY1.pdb.gz	GBRR3_HUMAN Gamma-aminobutyric acid receptor subunit rho-3 OS=Homo sapiens OX=9606 GN=GABRR3 PE=3 SV=2
6	AFDB:O14764	0.708	0.728	6.859E-45	452	0.323	0.332	O14764.pdb.gz	GBRD_HUMAN Gamma-aminobutyric acid receptor subunit delta OS=Homo sapiens OX=9606 GN=GABRD PE=1 SV=2
7	AFDB:Q08832	0.701	0.658	1.144E-44	496	0.381	0.357	Q08832.pdb.gz	GBRB3_DROME Gamma-aminobutyric acid receptor subunit beta-like OS=Drosophila melanogaster OX=7227 GN=Lcch3 PE=1 SV=2
8	AFDB:P47870	0.675	0.614	2.538E-44	512	0.363	0.330	P47870.pdb.gz	GBRB2_HUMAN Gamma-aminobutyric acid receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=GABRB2 PE=1 SV=2
9	AFDB:O18276	0.681	0.577	7.478E-44	550	0.383	0.324	O18276.pdb.gz	GBRB_CAEEL Gamma-aminobutyric acid receptor subunit beta OS=Caenorhabditis elegans OX=6239 GN=gab-1 PE=2 SV=3
10	AFDB:P63138	0.675	0.663	1.114E-43	474	0.359	0.352	P63138.pdb.gz	GBRB2_RAT Gamma-aminobutyric acid receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gabrb2 PE=1 SV=1
11	PDB:6i53B	0.671	0.916	1.694E-39	338	0.335	0.462	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.649	0.860	4.004E-33	349	0.269	0.358	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.600	0.807	1.442E-31	338	0.280	0.385	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.540	0.786	4.806E-23	311	0.138	0.206	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.488	0.710	6.417E-19	311	0.125	0.186	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.480	0.746	2.188E-15	288	0.116	0.188	6zgdA.pdb.gz
17	PDB:4aq5E	0.523	0.643	3.266E-13	370	0.116	0.146	4aq5E.pdb.gz
18	PDB:4afhA	0.344	0.714	5.768E-13	213	0.069	0.150	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:2w8gC	0.333	0.673	1.078E-12	217	0.084	0.180	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
20	PDB:5nzuD	0.099	0.106	2.705E-4	427	0.045	0.049	5nzuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MPY1	0.0	556	467	0.587	0.585	GBRR3_HUMAN Gamma-aminobutyric acid receptor subunit rho-3 OS=Homo sapiens OX=9606 GN=GABRR3 PE=3 SV=2
2	G1SEE5	0.0	693	479	0.716	0.695	G1SEE5_RABIT GABA(C) receptor OS=Oryctolagus cuniculus OX=9986 GN=GABRR1 PE=3 SV=3
3	P24046	0.0	683	479	0.712	0.691	GBRR1_HUMAN Gamma-aminobutyric acid receptor subunit rho-1 OS=Homo sapiens OX=9606 GN=GABRR1 PE=2 SV=2
4	P28476	0.0	968	465	1.000	1.000	GBRR2_HUMAN Gamma-aminobutyric acid receptor subunit rho-2 OS=Homo sapiens OX=9606 GN=GABRR2 PE=2 SV=5
5	P47742	0.0	891	465	0.912	0.912	GBRR2_RAT Gamma-aminobutyric acid receptor subunit rho-2 OS=Rattus norvegicus OX=10116 GN=Gabrr2 PE=1 SV=3
6	P50572	0.0	689	480	0.718	0.696	GBRR1_RAT Gamma-aminobutyric acid receptor subunit rho-1 OS=Rattus norvegicus OX=10116 GN=Gabrr1 PE=1 SV=2
7	P50573	0.0	563	464	0.596	0.597	GBRR3_RAT Gamma-aminobutyric acid receptor subunit rho-3 OS=Rattus norvegicus OX=10116 GN=Gabrr3 PE=1 SV=1
8	P56475	0.0	691	480	0.718	0.696	GBRR1_MOUSE Gamma-aminobutyric acid receptor subunit rho-1 OS=Mus musculus OX=10090 GN=Gabrr1 PE=2 SV=2
9	P56476	0.0	879	465	0.901	0.901	GBRR2_MOUSE Gamma-aminobutyric acid receptor subunit rho-2 OS=Mus musculus OX=10090 GN=Gabrr2 PE=2 SV=4
10	Q5TZ16	0.0	643	466	0.688	0.687	Q5TZ16_DANRE Gamma-aminobutyric acid receptor subunit rho-1 precursor OS=Danio rerio OX=7955 GN=si:dkey-77b17.3 PE=3 SV=1
11	P63079	3.94e-108	330	473	0.376	0.370	GBRB3_RAT Gamma-aminobutyric acid receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Gabrb3 PE=1 SV=1
12	P63080	3.94e-108	330	473	0.376	0.370	GBRB3_MOUSE Gamma-aminobutyric acid receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Gabrb3 PE=1 SV=1
13	P28472	8.13e-108	329	473	0.370	0.364	GBRB3_HUMAN Gamma-aminobutyric acid receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=GABRB3 PE=1 SV=1
14	P15431	1.32e-105	324	474	0.361	0.354	GBRB1_RAT Gamma-aminobutyric acid receptor subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Gabrb1 PE=1 SV=1
15	P50571	2.45e-105	323	474	0.361	0.354	GBRB1_MOUSE Gamma-aminobutyric acid receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Gabrb1 PE=1 SV=1
16	P18505	3.24e-105	323	474	0.359	0.352	GBRB1_HUMAN Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=GABRB1 PE=1 SV=2
17	P63138	3.49e-103	318	474	0.372	0.365	GBRB2_RAT Gamma-aminobutyric acid receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gabrb2 PE=1 SV=1
18	Q08832	2.30e-102	316	496	0.394	0.369	GBRB3_DROME Gamma-aminobutyric acid receptor subunit beta-like OS=Drosophila melanogaster OX=7227 GN=Lcch3 PE=1 SV=2
19	A4FUK8	6.57e-97	303	519	0.327	0.293	A4FUK8_DANRE Gabrb2 protein OS=Danio rerio OX=7955 GN=gabrb2 PE=2 SV=1
20	Q9DDD9	6.46e-96	300	519	0.299	0.268	Q9DDD9_DANRE GABAA receptor betaZ2 subunit OS=Danio rerio OX=7955 GN=gabaabeta2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	1e-48	177.2	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	2.2e-31	121.3	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412673	0.847	Gamma-aminobutyric acid receptor subunit rho-1
2	9606.ENSP00000481321	0.805	Gamma-aminobutyric acid receptor subunit rho-3
3	9606.ENSP00000482232	0.769	Glycoprotein hormones, alpha polypeptide
4	9606.ENSP00000332413	0.641	Bestrophin-3
5	9606.ENSP00000478767	0.627	Neurabin-2
6	9606.ENSP00000325285	0.617	Myotubularin-related protein 4
7	9606.ENSP00000371728	0.610	Neurensin-2
8	9606.ENSP00000419378	0.608	Chloride intracellular channel protein 3
9	9606.ENSP00000421917	0.606	HMG domain-containing protein 3
10	9606.ENSP00000358497	0.605	mRNA-capping enzyme
11	9606.ENSP00000421828	0.599	Gamma-aminobutyric acid receptor subunit alpha-2
12	9606.ENSP00000479113	0.598	Gamma-aminobutyric acid receptor subunit gamma-3
13	9606.ENSP00000359353	0.597	Gamma-aminobutyric acid receptor subunit epsilon
14	9606.ENSP00000247226	0.592	Pleckstrin homology and RhoGEF domain containing G3
15	9606.ENSP00000264318	0.592	Gamma-aminobutyric acid receptor subunit alpha-4
16	9606.ENSP00000469332	0.591	Gamma-aminobutyric acid receptor subunit theta
17	9606.ENSP00000393097	0.590	Gamma-aminobutyric acid receptor subunit alpha-1
18	9606.ENSP00000410732	0.590	Gamma-aminobutyric acid receptor subunit gamma-2
19	9606.ENSP00000295452	0.588	Gamma-aminobutyric acid receptor subunit gamma-1
20	9606.ENSP00000335592	0.587	Gamma-aminobutyric acid receptor subunit alpha-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004890	0.999	GABA-A receptor activity
GO:0005230	0.999	extracellular ligand-gated monoatomic ion channel activity
GO:0015103	0.995	inorganic anion transmembrane transporter activity
GO:0005254	0.993	chloride channel activity
GO:0005488	0.989	binding
GO:0030594	0.981	neurotransmitter receptor activity
GO:0005515	0.964	protein binding
GO:0022824	0.958	transmitter-gated monoatomic ion channel activity
GO:0098960	0.532	postsynaptic neurotransmitter receptor activity
GO:0099529	0.516	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.512	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005231	0.473	excitatory extracellular ligand-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0023052	0.987	signaling
GO:0065007	0.974	biological regulation
GO:0007154	0.968	cell communication
GO:0050789	0.959	regulation of biological process
GO:0007267	0.957	cell-cell signaling
GO:0050794	0.914	regulation of cellular process
GO:0099536	0.676	synaptic signaling
GO:0099537	0.668	trans-synaptic signaling
GO:0007268	0.648	chemical synaptic transmission
GO:0006811	0.593	monoatomic ion transport
GO:0050896	0.556	response to stimulus
GO:0006821	0.506	chloride transport
GO:0051716	0.455	cellular response to stimulus
GO:0032501	0.449	multicellular organismal process
GO:0007165	0.327	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.698	organelle
GO:0045202	0.567	synapse
GO:0043227	0.520	membrane-bounded organelle
GO:0042995	0.342	cell projection
GO:0120025	0.323	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.994	chloride(in) = chloride(out)

[back to server]