StarFunc result for job id P28482

User Input

>input (360 residues)
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VH14	0.950	0.927	9.636E-59	369	0.931	0.908	Q4VH14.pdb.gz
2	PDB:7opmA	0.953	0.947	1.336E-58	362	0.992	0.986	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
3	AFDB:Q7ZVK8	0.949	0.872	2.249E-57	392	0.872	0.801	Q7ZVK8.pdb.gz	Q7ZVK8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=wu:fi06b09 PE=1 SV=1
4	AFDB:P21708	0.942	0.893	1.340E-56	380	0.872	0.826	P21708.pdb.gz	MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Mapk3 PE=1 SV=5
5	AFDB:P39745	0.950	0.772	4.285E-55	444	0.769	0.624	P39745.pdb.gz	MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans OX=6239 GN=mpk-1 PE=1 SV=2
6	AFDB:P40417	0.937	0.898	6.569E-54	376	0.789	0.755	P40417.pdb.gz	ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster OX=7227 GN=rl PE=1 SV=3
7	PDB:5bvdA	0.892	0.972	2.892E-53	330	0.917	1.000	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
8	PDB:2zoqA	0.940	0.961	2.623E-52	352	0.847	0.866	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
9	AFDB:G4N0Z0	0.907	0.917	4.184E-44	356	0.558	0.565	G4N0Z0.pdb.gz	PMK1_MAGO7 Mitogen-activated protein kinase PMK11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=PMK1 PE=1 SV=1
10	AFDB:P27638	0.914	0.885	2.769E-43	372	0.531	0.513	P27638.pdb.gz	SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spk1 PE=1 SV=1
11	AFDB:O42781	0.913	0.936	2.918E-43	351	0.547	0.561	O42781.pdb.gz	MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii OX=4754 GN=MKP2 PE=1 SV=1
12	AFDB:Q5A1D3	0.908	0.778	2.790E-42	421	0.550	0.470	Q5A1D3.pdb.gz	ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CEK1 PE=1 SV=3
13	AFDB:A9T142	0.914	0.878	7.972E-42	375	0.500	0.480	A9T142.pdb.gz	MPK4A_PHYPA Mitogen-activated protein kinase 4a OS=Physcomitrium patens OX=3218 GN=MPK4a PE=1 SV=1
14	PDB:2b9iA	0.873	0.928	1.572E-36	338	0.481	0.512	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
15	PDB:2lgcA	0.864	0.866	2.428E-34	359	0.467	0.468	2lgcA.pdb.gz
16	PDB:6dtlB	0.880	0.887	2.697E-34	357	0.489	0.493	6dtlB.pdb.gz
17	PDB:2ewaA	0.838	0.911	1.303E-33	330	0.433	0.473	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
18	PDB:3gc8A	0.852	0.883	2.578E-33	347	0.436	0.452	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
19	PDB:7cgaA	0.861	0.892	5.971E-33	347	0.397	0.412	7cgaA.pdb.gz
20	PDB:3coiA	0.827	0.863	1.080E-30	344	0.397	0.416	3coiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4LQZ8	0.0	604	375	0.794	0.763	B4LQZ8_DROVI Mitogen-activated protein kinase OS=Drosophila virilis OX=7244 GN=Dvir\GJ17518 PE=3 SV=1
2	D5GW36	0.0	576	370	0.756	0.735	D5GW36_9BILA mitogen-activated protein kinase (Fragment) OS=Acrobeloides sp. PS-1146 OX=403146 GN=mpk-1 PE=2 SV=1
3	P21708	0.0	651	380	0.844	0.800	MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Mapk3 PE=1 SV=5
4	P26696	0.0	720	361	0.961	0.958	MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis OX=8355 GN=mapk1 PE=1 SV=3
5	P27361	0.0	652	379	0.856	0.813	MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4
6	P28482	0.0	750	360	1.000	1.000	MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3
7	P39745	0.0	572	444	0.767	0.622	MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans OX=6239 GN=mpk-1 PE=1 SV=2
8	P40417	0.0	598	376	0.783	0.750	ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster OX=7227 GN=rl PE=1 SV=3
9	P63085	0.0	742	358	0.986	0.992	MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus OX=10090 GN=Mapk1 PE=1 SV=3
10	P63086	0.0	742	358	0.986	0.992	MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Mapk1 PE=1 SV=3
11	Q63844	0.0	650	380	0.844	0.800	MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapk3 PE=1 SV=5
12	Q7ZVK8	0.0	663	392	0.869	0.798	Q7ZVK8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=wu:fi06b09 PE=1 SV=1
13	Q7ZW72	0.0	702	369	0.936	0.913	Q7ZW72_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=zERK2 PE=1 SV=1
14	C8V7D1	4.26e-137	396	354	0.567	0.576	C8V7D1_EMENI Mitogen-activated protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mpkB PE=1 SV=1
15	G4N0Z0	5.04e-137	395	356	0.558	0.565	PMK1_MAGO7 Mitogen-activated protein kinase PMK11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=PMK1 PE=1 SV=1
16	Q8X1A2	1.19e-136	395	355	0.564	0.572	Q8X1A2_GIBZA Mitogen-activated protein kinase OS=Gibberella zeae OX=5518 GN=pmk1 PE=3 SV=1
17	Q92246	1.97e-136	394	356	0.556	0.562	PMK1_MAGOR Mitogen-activated protein kinase PMK1 OS=Magnaporthe oryzae OX=318829 GN=PMK1 PE=1 SV=2
18	P27638	1.41e-132	385	372	0.525	0.508	SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spk1 PE=1 SV=1
19	O42781	1.46e-130	379	351	0.547	0.561	MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii OX=4754 GN=MKP2 PE=1 SV=1
20	P42525	1.38e-125	373	529	0.519	0.353	ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum OX=44689 GN=erkA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.1	19.0	ABC1 atypical kinase-like domain
2	PF01636 APH	4.1	18.7	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	1.2e+02	13.7	Choline/ethanolamine kinase
4	PF13095 FTA2	1.1e+02	13.9	Kinetochore Sim4 complex subunit FTA2
5	PF12330 Haspin_kinase	96	13.4	Haspin like kinase domain
6	PF06293 Kdo	4.2e+02	11.7	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	4.9e+02	11.4	Kinase-like
8	PF00069 Pkinase	1.6e-65	232.7	Protein kinase domain
9	PF17667 Pkinase_fungal	4.3e+02	11.0	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	7.6e-32	122.2	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006877696.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006870770.1	0.977	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 20 Proteins
2	185453.XP_006862551.1	0.968	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 20 Proteins
3	185453.XP_006877046.1	0.967	GTPase HRas isoform X1
4	185453.XP_006867015.1	0.966	GTPase KRas isoform X1
5	185453.XP_006870526.1	0.966	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 10 Proteins
6	185453.XP_006862317.1	0.965	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 26 Proteins
7	185453.XP_006876078.1	0.965	Dual specificity protein phosphatase 7
8	185453.XP_006865940.1	0.963	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 10 Proteins
9	185453.XP_006831925.1	0.962	Guanine nucleotide-binding protein subunit beta-5
10	185453.XP_006861706.1	0.962	Astrocytic phosphoprotein PEA-15
11	185453.XP_006864280.1	0.954	ETS domain-containing protein Elk-1
12	185453.XP_006834195.1	0.952	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
13	185453.XP_006863449.1	0.951	Cellular tumor antigen p53
14	185453.XP_006831576.1	0.947	Dual specificity mitogen-activated protein kinase kinase 1
15	185453.XP_006859619.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 39 Proteins
16	185453.XP_006868997.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins
17	185453.XP_006871240.1	0.947	Ribosomal protein S6 kinase alpha-2 isoform X1
18	185453.XP_006835645.1	0.943	Ribosomal protein S6 kinase alpha-3 isoform X1
19	185453.XP_006869043.1	0.942	MAP kinase-interacting serine/threonine-protein kinase 2
20	185453.XP_006865897.1	0.938	Tyrosine-protein phosphatase non-receptor type 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004707	0.998	MAP kinase activity
GO:0043167	0.615	ion binding
GO:1901363	0.449	heterocyclic compound binding
GO:0097159	0.449	organic cyclic compound binding
GO:0019899	0.442	enzyme binding
GO:0097367	0.419	carbohydrate derivative binding
GO:0035639	0.411	purine ribonucleoside triphosphate binding
GO:0017076	0.410	purine nucleotide binding
GO:0032555	0.404	purine ribonucleotide binding
GO:0042802	0.346	identical protein binding
GO:0032559	0.317	adenyl ribonucleotide binding
GO:0005524	0.300	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0023052	0.924	signaling
GO:0050896	0.875	response to stimulus
GO:0051716	0.832	cellular response to stimulus
GO:0007154	0.821	cell communication
GO:0071704	0.818	organic substance metabolic process
GO:0048518	0.814	positive regulation of biological process
GO:0019222	0.807	regulation of metabolic process
GO:0032501	0.799	multicellular organismal process
GO:0048522	0.797	positive regulation of cellular process
GO:0060255	0.796	regulation of macromolecule metabolic process
GO:0080090	0.792	regulation of primary metabolic process
GO:0051171	0.792	regulation of nitrogen compound metabolic process
GO:0032502	0.778	developmental process
GO:0048856	0.752	anatomical structure development
GO:0044238	0.745	primary metabolic process
GO:0007165	0.710	signal transduction
GO:0006807	0.697	nitrogen compound metabolic process
GO:0043170	0.667	macromolecule metabolic process
GO:1901564	0.643	organonitrogen compound metabolic process
GO:0009893	0.633	positive regulation of metabolic process
GO:0010604	0.622	positive regulation of macromolecule metabolic process
GO:0044237	0.619	cellular metabolic process
GO:0051173	0.610	positive regulation of nitrogen compound metabolic process
GO:0036211	0.605	protein modification process
GO:0065009	0.589	regulation of molecular function
GO:0071840	0.481	cellular component organization or biogenesis
GO:0035556	0.429	intracellular signal transduction
GO:0051246	0.411	regulation of protein metabolic process
GO:0031323	0.406	regulation of cellular metabolic process
GO:0016043	0.383	cellular component organization
GO:0007275	0.377	multicellular organism development
GO:0006796	0.366	phosphate-containing compound metabolic process
GO:0042221	0.350	response to chemical
GO:0051247	0.326	positive regulation of protein metabolic process
GO:0050790	0.324	regulation of catalytic activity
GO:0048583	0.316	regulation of response to stimulus
GO:0023051	0.301	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.997	nucleus
GO:0070013	0.975	intracellular organelle lumen
GO:0016020	0.969	membrane
GO:0071944	0.967	cell periphery
GO:0005829	0.958	cytosol
GO:0005886	0.955	plasma membrane
GO:0005654	0.955	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0032991	0.885	protein-containing complex
GO:0012505	0.742	endomembrane system
GO:0005856	0.432	cytoskeleton
GO:0031410	0.350	cytoplasmic vesicle
GO:0005901	0.319	caveola

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	0.998	mitogen-activated protein kinase.

[back to server]