StarFunc result for job id P28562

User Input

>input (367 residues)
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28562	1.000	1.000	2.028E-78	367	1.000	1.000	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
2	AFDB:Q91790	0.435	0.433	4.408E-63	369	0.785	0.780	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
3	AFDB:A0A2R8QPP3	0.805	0.805	6.588E-55	367	0.624	0.624	A0A2R8QPP3.pdb.gz
4	AFDB:Q62767	0.771	0.719	4.260E-53	395	0.640	0.595	Q62767.pdb.gz	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
5	AFDB:Q05922	0.762	0.876	2.041E-44	318	0.455	0.525	Q05922.pdb.gz	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
6	AFDB:O54838	0.392	0.374	1.320E-42	384	0.450	0.430	O54838.pdb.gz	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
7	AFDB:Q05923	0.761	0.886	3.520E-42	314	0.444	0.519	Q05923.pdb.gz	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
8	AFDB:O09112	0.376	0.212	2.420E-31	663	0.305	0.169	O09112.pdb.gz	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
9	AFDB:Q7T2L8	0.389	0.373	4.750E-31	382	0.311	0.298	Q7T2L8.pdb.gz	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
10	AFDB:A0A024RAR2	0.370	0.206	1.054E-30	665	0.319	0.176	A0A024RAR2.pdb.gz
11	PDB:6d66A	0.395	0.281	2.274E-27	517	0.390	0.277	6d66A.pdb.gz
12	PDB:2wgpA	0.379	0.820	8.241E-18	168	0.155	0.339	2wgpA.pdb.gz
13	PDB:2esbA	0.379	0.848	3.376E-17	162	0.144	0.327	2esbA.pdb.gz
14	PDB:5y15A	0.376	0.912	3.048E-14	148	0.128	0.318	5y15A.pdb.gz
15	PDB:2gwoC	0.358	0.739	3.541E-13	174	0.136	0.287	2gwoC.pdb.gz
16	PDB:5xjvB	0.357	0.751	7.857E-13	171	0.144	0.310	5xjvB.pdb.gz
17	PDB:3f81A	0.363	0.725	1.207E-12	179	0.142	0.291	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
18	PDB:2y96A	0.358	0.733	3.422E-12	175	0.123	0.257	2y96A.pdb.gz
19	PDB:2q05A	0.338	0.659	2.571E-9	181	0.090	0.182	2q05A.pdb.gz
20	PDB:4ercA	0.335	0.783	5.704E-9	150	0.071	0.173	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28562	0.0	754	367	1.000	1.000	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
2	P28563	0.0	728	367	0.965	0.965	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
3	Q64623	0.0	734	367	0.970	0.970	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
4	Q91790	0.0	596	369	0.785	0.780	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
5	Q62767	5.30e-165	468	395	0.624	0.580	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
6	Q13115	5.65e-165	468	394	0.624	0.581	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
7	Q7SZF3	2.41e-160	456	367	0.613	0.613	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
8	Q05922	7.89e-108	320	318	0.463	0.535	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
9	Q05923	1.42e-106	317	314	0.444	0.519	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
10	Q16690	5.27e-97	295	384	0.485	0.464	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2
11	O54838	5.01e-92	282	384	0.469	0.448	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
12	Q16829	1.39e-52	181	419	0.332	0.291	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
13	Q7T2L8	1.98e-51	177	382	0.330	0.317	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
14	Q9DBB1	5.23e-47	166	381	0.302	0.291	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
15	Q64346	6.13e-47	166	381	0.297	0.286	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
16	Q16828	2.16e-46	164	381	0.294	0.283	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
17	D4A3W6	2.38e-45	166	661	0.278	0.154	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1
18	Q9BY84	2.96e-45	166	665	0.281	0.155	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
19	Q10038	1.26e-44	164	657	0.292	0.163	VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans OX=6239 GN=vhp-1 PE=1 SV=2
20	O09112	1.55e-43	161	663	0.297	0.164	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	7.6e-45	163.4	Dual specificity phosphatase, catalytic domain
2	PF04179 Init_tRNA_PT	2.3e+02	13.5	Rit1 DUSP-like domain
3	PF00581 Rhodanese	7.8e-07	40.9	Rhodanese-like domain
4	PF00102 Y_phosphatase	0.1	23.7	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006978

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000011327	0.987	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
2	9593.ENSGGOP00000008752	0.986	Mitogen-activated protein kinase 3
3	9593.ENSGGOP00000011486	0.968	Mitogen-activated protein kinase 8
4	9593.ENSGGOP00000003092	0.944	Mitogen-activated protein kinase 10
5	9593.ENSGGOP00000023054	0.944	Mitogen-activated protein kinase 11
6	9593.ENSGGOP00000023531	0.937	Mitogen-activated protein kinase 9
7	9593.ENSGGOP00000014110	0.920	Mitogen-activated protein kinase 12
8	9593.ENSGGOP00000003875	0.902	Mitogen-activated protein kinase 13
9	9593.ENSGGOP00000000519	0.894	Fos proto-oncogene, AP-1 transcription factor subunit
10	9593.ENSGGOP00000014039	0.844	ZFP36 ring finger protein
11	9593.ENSGGOP00000003172	0.837	Jun proto-oncogene, AP-1 transcription factor subunit
12	9593.ENSGGOP00000001830	0.804	BTG family, member 2
13	9593.ENSGGOP00000004255	0.740	Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
14	9593.ENSGGOP00000023457	0.740	Uncharacterized protein
15	9593.ENSGGOP00000009178	0.730	NFKB inhibitor alpha
16	9593.ENSGGOP00000021346	0.729	FosB proto-oncogene, AP-1 transcription factor subunit
17	9593.ENSGGOP00000025921	0.696	Dual specificity phosphatase 6
18	9593.ENSGGOP00000005646	0.694	Uncharacterized protein
19	9593.ENSGGOP00000019277	0.694	Uncharacterized protein
20	9593.ENSGGOP00000003173	0.690	CD4 molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0004725	0.949	protein tyrosine phosphatase activity
GO:0033549	0.916	MAP kinase phosphatase activity
GO:0019899	0.684	enzyme binding
GO:0019900	0.516	kinase binding
GO:0019901	0.421	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0044237	0.991	cellular metabolic process
GO:0048519	0.986	negative regulation of biological process
GO:0043170	0.986	macromolecule metabolic process
GO:0048583	0.984	regulation of response to stimulus
GO:0048523	0.981	negative regulation of cellular process
GO:0043412	0.978	macromolecule modification
GO:0044238	0.972	primary metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0023051	0.961	regulation of signaling
GO:0010646	0.961	regulation of cell communication
GO:0009966	0.951	regulation of signal transduction
GO:0006470	0.949	protein dephosphorylation
GO:0043408	0.936	regulation of MAPK cascade
GO:1902532	0.922	negative regulation of intracellular signal transduction
GO:0043409	0.852	negative regulation of MAPK cascade
GO:0050896	0.794	response to stimulus
GO:0019222	0.793	regulation of metabolic process
GO:0060255	0.750	regulation of macromolecule metabolic process
GO:0031323	0.731	regulation of cellular metabolic process
GO:0051171	0.716	regulation of nitrogen compound metabolic process
GO:0080090	0.641	regulation of primary metabolic process
GO:0048518	0.583	positive regulation of biological process
GO:0048522	0.536	positive regulation of cellular process
GO:0051716	0.518	cellular response to stimulus
GO:0007165	0.425	signal transduction
GO:0009892	0.364	negative regulation of metabolic process
GO:0031326	0.351	regulation of cellular biosynthetic process
GO:0010556	0.349	regulation of macromolecule biosynthetic process
GO:0042221	0.345	response to chemical
GO:0019219	0.343	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.323	negative regulation of macromolecule metabolic process
GO:0051172	0.322	negative regulation of nitrogen compound metabolic process
GO:0031324	0.322	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.977	cytoplasm
GO:0070013	0.407	intracellular organelle lumen
GO:0031981	0.399	nuclear lumen
GO:0005829	0.383	cytosol
GO:0005654	0.370	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.949	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.949	protein-tyrosine-phosphatase.

[back to server]