StarFunc result for job id P28698

User Input

>input (734 residues)
MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQE
ALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVD
GLRREPGGPRRWVTVQVQGQEVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLG
LQVKEESEVTEDSDFLESGPLAATQESVPTLLPEEAQRCGTVLDQIFPHSKTGPEGPSWR
EHPRALWHEEAGGIFSPGFALQLGSISAGPGSVSPHLHVPWDLGMAGLSGQIQSPSREGG
FAHALLLPSDLRSEQDPTDEDPCRGVGPALITTRWRSPRGRSRGRPSTGGGVVRGGRCDV
CGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPE
PPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERP
FACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACP
ECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQ
SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQ
STKLIQHQRVHSAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4T5	0.476	0.476	0.000	734	1.000	1.000	A0A024R4T5.pdb.gz
2	AFDB:Q96SZ4	0.290	0.294	4.369E-47	725	0.350	0.354	Q96SZ4.pdb.gz	ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZSCAN10 PE=1 SV=1
3	AFDB:O43309	0.242	0.283	1.618E-43	604	0.335	0.407	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
4	AFDB:Q6ZNH5	0.316	0.446	3.095E-43	498	0.287	0.424	Q6ZNH5.pdb.gz	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
5	AFDB:P59923	0.270	0.204	3.449E-43	1031	0.364	0.259	P59923.pdb.gz	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
6	AFDB:Q9UJW7	0.326	0.293	4.770E-43	825	0.322	0.286	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
7	AFDB:O60765	0.345	0.398	7.681E-41	605	0.277	0.336	O60765.pdb.gz	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
8	AFDB:P52736	0.347	0.386	1.728E-40	654	0.272	0.306	P52736.pdb.gz	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
9	AFDB:Q8N184	0.329	0.368	1.728E-40	647	0.262	0.297	Q8N184.pdb.gz	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
10	AFDB:Q86UD4	0.354	0.455	3.888E-40	541	0.264	0.359	Q86UD4.pdb.gz	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
11	PDB:3w5kB	0.073	0.276	2.848E-4	110	0.053	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.030	0.238	8.049E-1	62	0.019	0.226	6ydhA.pdb.gz
13	PDB:5dkaA	0.037	0.166	2.130	96	0.026	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7ad8D	0.041	0.077	2.373	280	0.031	0.082	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:4cabA	0.050	0.067	2.505	507	0.041	0.059	4cabA.pdb.gz	Structure of the Mono-Functional Heme Catalase Dr1998 from Deinococcus Radiodurans
16	PDB:4kfzB	0.046	0.145	2.505	148	0.037	0.182	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:7dvqM	0.032	0.094	2.946	191	0.041	0.157	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:7r24A	0.053	0.193	3.109	150	0.019	0.093	7r24A.pdb.gz
19	PDB:7eghA	0.037	0.042	4.074	630	0.045	0.052	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:7o4iW	0.037	0.069	4.074	312	0.040	0.093	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28698	0.0	1462	734	1.000	1.000	MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens OX=9606 GN=MZF1 PE=1 SV=3
2	Q9P0L1	6.13e-155	469	754	0.401	0.390	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
3	Q9UEG4	1.15e-136	426	869	0.285	0.241	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
4	Q49A12	1.01e-134	410	536	0.248	0.340	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
5	Q03923	2.95e-134	411	595	0.248	0.306	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q8TBZ5	4.80e-134	409	544	0.274	0.369	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
7	Q8TAQ5	1.06e-131	407	688	0.262	0.279	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
8	O75123	1.22e-131	402	536	0.248	0.340	ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens OX=9606 GN=ZNF623 PE=1 SV=3
9	P51523	1.92e-131	408	738	0.256	0.255	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	P15622	4.12e-131	402	560	0.260	0.341	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
11	P17020	4.13e-131	405	682	0.253	0.273	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
12	Q9Y2P0	4.56e-131	400	537	0.260	0.356	ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens OX=9606 GN=ZNF835 PE=1 SV=2
13	Q7TMN8	5.77e-131	402	578	0.264	0.336	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
14	Q8BLA2	1.76e-130	400	578	0.264	0.336	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
15	Q9EQB9	1.34e-129	404	759	0.358	0.347	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
16	Q8N184	1.59e-129	400	647	0.255	0.289	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
17	P15620	1.63e-129	398	580	0.244	0.309	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
18	P17027	5.64e-129	399	643	0.253	0.289	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
19	P52742	6.80e-129	399	658	0.263	0.293	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
20	Q6ZN57	9.45e-129	392	461	0.251	0.399	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.12	23.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF11672 DUF3268	1.1e+02	14.5	zinc-finger-containing domain
3	PF05129 Elf1	3.3e+02	12.7	Transcription elongation factor Elf1 like
4	PF09538 FYDLN_acid	2.4	20.2	Protein of unknown function (FYDLN_acid)
5	PF07754 HVO_2753_ZBP	48	15.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
6	PF01155 HypA	0.038	25.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
7	PF00412 LIM	5.3	18.7	LIM domain
8	PF01429 MBD	60	14.8	Methyl-CpG binding domain
9	PF10484 MRP-S23	7.4e+02	11.8	Mitochondrial ribosomal protein S23
10	PF05810 NinF	2.1e+02	13.0	NinF protein
11	PF02023 SCAN	2.2e-33	125.2	SCAN domain
12	PF14149 YhfH	5.3e+02	12.0	YhfH-like protein
13	PF00096 zf-C2H2	4.5e-64	220.6	Zinc finger, C2H2 type
14	PF13894 zf-C2H2_4	7.3e-37	133.8	C2H2-type zinc finger
15	PF13912 zf-C2H2_6	2.1e-06	38.8	C2H2-type zinc finger
16	PF15909 zf-C2H2_8	0.027	26.1	C2H2-type zinc ribbon
17	PF16293 zf-C2H2_9	7.9e+02	11.3	C2H2 type zinc-finger (1 copy)
18	PF12171 zf-C2H2_jaz	0.042	25.4	Zinc-finger double-stranded RNA-binding
19	PF16278 zf-C2HE	19	17.1	C2HE / C2H2 / C2HC zinc-binding finger
20	PF13465 zf-H2C2_2	6e-77	262.2	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309572	0.900	Telomerase reverse transcriptase
2	9606.ENSP00000252590	0.720	Plasmalemma vesicle-associated protein
3	9606.ENSP00000381928	0.642	Protein MGARP
4	9606.ENSP00000260118	0.630	Gamma-glutamyl hydrolase
5	9606.ENSP00000326272	0.596	Forkhead box protein L1
6	9606.ENSP00000290431	0.593	Polycystic kidney disease 2-like 2 protein
7	9606.ENSP00000426033	0.573	Hairy and enhancer of split-related protein HELT
8	9606.ENSP00000472249	0.572	Glia maturation factor gamma
9	9606.ENSP00000299767	0.560	Endoplasmin
10	9606.ENSP00000404464	0.560	Collagen and calcium-binding EGF domain-containing protein 1
11	9606.ENSP00000441434	0.557	Nicotinamide N-methyltransferase
12	9606.ENSP00000298532	0.553	snRNA-activating protein complex subunit 4
13	9606.ENSP00000365858	0.551	Erythroid transcription factor
14	9606.ENSP00000282326	0.547	Zinc finger and SCAN domain-containing protein 1
15	9606.ENSP00000294339	0.546	T-cell acute lymphocytic leukemia protein 1
16	9606.ENSP00000367615	0.546	Adenine phosphoribosyltransferase
17	9606.ENSP00000361820	0.544	Protein BHLHb9
18	9606.ENSP00000433109	0.538	Potassium voltage-gated channel subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.956	sequence-specific double-stranded DNA binding
GO:0140110	0.937	transcription regulator activity
GO:0003700	0.929	DNA-binding transcription factor activity
GO:0042802	0.726	identical protein binding
GO:0000981	0.698	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.319	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.977	positive regulation of cellular process
GO:0048523	0.916	negative regulation of cellular process
GO:0010604	0.913	positive regulation of macromolecule metabolic process
GO:0045893	0.900	positive regulation of DNA-templated transcription
GO:0010605	0.874	negative regulation of macromolecule metabolic process
GO:0051172	0.853	negative regulation of nitrogen compound metabolic process
GO:0031324	0.851	negative regulation of cellular metabolic process
GO:0045934	0.771	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.768	negative regulation of cellular biosynthetic process
GO:0051253	0.761	negative regulation of RNA metabolic process
GO:0010558	0.759	negative regulation of macromolecule biosynthetic process
GO:1902679	0.751	negative regulation of RNA biosynthetic process
GO:0045892	0.742	negative regulation of DNA-templated transcription
GO:0006357	0.734	regulation of transcription by RNA polymerase II
GO:0045944	0.540	positive regulation of transcription by RNA polymerase II
GO:0009987	0.465	cellular process
GO:0000122	0.406	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]