StarFunc result for job id P28702

User Input

>input (533 residues)
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z570	0.622	0.617	2.421E-60	537	1.000	0.993	A0A0S2Z570.pdb.gz	A0A0S2Z570_HUMAN RXRB (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
2	AFDB:A0A0S2Z4M5	0.593	0.621	6.857E-55	508	0.953	1.000	A0A0S2Z4M5.pdb.gz	A0A0S2Z4M5_HUMAN Retinoid X receptor beta isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=1
3	AFDB:Q90416	0.609	0.730	7.307E-42	441	0.591	0.714	Q90416.pdb.gz	RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio OX=7955 GN=rxrga PE=2 SV=2
4	PDB:3dzyA	0.540	0.945	2.048E-33	302	0.503	0.887	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
5	AFDB:P20153	0.515	0.539	1.081E-26	508	0.388	0.407	P20153.pdb.gz	USP_DROME Protein ultraspiracle OS=Drosophila melanogaster OX=7227 GN=usp PE=1 SV=1
6	AFDB:A0A6E1WB48	0.396	0.462	3.038E-24	455	0.280	0.327	A0A6E1WB48.pdb.gz	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
7	AFDB:F1NZ15	0.392	0.447	5.629E-24	466	0.278	0.318	F1NZ15.pdb.gz	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
8	AFDB:Q6PHH5	0.397	0.454	8.744E-24	463	0.287	0.330	Q6PHH5.pdb.gz
9	AFDB:P22448	0.520	0.601	5.092E-23	455	0.248	0.290	P22448.pdb.gz	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
10	AFDB:F1D8T1	0.397	0.445	1.030E-22	474	0.281	0.316	F1D8T1.pdb.gz	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
11	AFDB:Q5RJ38	0.440	0.512	1.748E-22	444	0.250	0.300	Q5RJ38.pdb.gz	Q5RJ38_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errb/g PE=3 SV=2
12	PDB:1g2nA	0.357	0.751	1.920E-13	246	0.197	0.427	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.368	0.783	2.046E-11	238	0.116	0.261	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.318	0.611	6.614E-6	259	0.083	0.170	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:3lomA	0.088	0.143	2.261E-1	288	0.069	0.128	3lomA.pdb.gz
16	PDB:3fr8B	0.100	0.102	4.575E-1	517	0.068	0.070	3fr8B.pdb.gz	Conformational changes in a plant ketol-acid reductoisomerase upon Mg(2+) and NADPH binding as revealed by two crystal structures
17	PDB:4q25A	0.122	0.226	5.221E-1	211	0.051	0.128	4q25A.pdb.gz
18	PDB:5ogeG	0.085	0.123	5.702E-1	306	0.051	0.088	5ogeG.pdb.gz
19	PDB:1is2A	0.114	0.101	7.762E-1	637	0.058	0.049	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
20	PDB:6yupD	0.104	0.143	8.858E-1	328	0.041	0.067	6yupD.pdb.gz	Structural basis for amino acid exchange by a human heteromeric amino acid transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4M5	1010	508	0.953	1.000	A0A0S2Z4M5_HUMAN Retinoid X receptor beta isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=1
2	A0A0S2Z570	1070	537	1.000	0.993	A0A0S2Z570_HUMAN RXRB (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
3	A0A1D5P2B5	637	467	0.614	0.700	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
4	P19793	636	462	0.612	0.706	RXRA_HUMAN Retinoic acid receptor RXR-alpha OS=Homo sapiens OX=9606 GN=RXRA PE=1 SV=1
5	P28700	632	467	0.617	0.704	RXRA_MOUSE Retinoic acid receptor RXR-alpha OS=Mus musculus OX=10090 GN=Rxra PE=1 SV=1
6	P28701	588	467	0.563	0.642	RXRG_CHICK Retinoic acid receptor RXR-gamma OS=Gallus gallus OX=9031 GN=RXRG PE=2 SV=1
7	P28702	1076	533	1.000	1.000	RXRB_HUMAN Retinoic acid receptor RXR-beta OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=2
8	P28704	1011	520	0.947	0.971	RXRB_MOUSE Retinoic acid receptor RXR-beta OS=Mus musculus OX=10090 GN=Rxrb PE=1 SV=2
9	P28705	596	463	0.591	0.680	RXRG_MOUSE Retinoic acid receptor RXR-gamma OS=Mus musculus OX=10090 GN=Rxrg PE=2 SV=2
10	P48443	595	463	0.591	0.680	RXRG_HUMAN Retinoic acid receptor RXR-gamma OS=Homo sapiens OX=9606 GN=RXRG PE=1 SV=1
11	P49743	898	458	0.837	0.974	RXRB_RAT Retinoic acid receptor RXR-beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Rxrb PE=1 SV=1
12	P51128	620	488	0.600	0.656	RXRA_XENLA Retinoic acid receptor RXR-alpha OS=Xenopus laevis OX=8355 GN=rxra PE=1 SV=1
13	P51129	590	470	0.561	0.636	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
14	Q05343	632	467	0.612	0.698	RXRA_RAT Retinoic acid receptor RXR-alpha OS=Rattus norvegicus OX=10116 GN=Rxra PE=1 SV=1
15	Q5BJR8	600	463	0.595	0.685	RXRG_RAT Retinoic acid receptor RXR-gamma OS=Rattus norvegicus OX=10116 GN=Rxrg PE=1 SV=1
16	Q5STP9	1076	533	1.000	1.000	Q5STP9_HUMAN Retinoid X nuclear receptor beta OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
17	Q7SYN5	655	471	0.627	0.709	RXRBA_DANRE Retinoic acid receptor RXR-beta-A OS=Danio rerio OX=7955 GN=rxrba PE=2 SV=1
18	Q90415	605	379	0.555	0.781	RXRAB_DANRE Retinoic acid receptor RXR-alpha-B OS=Danio rerio OX=7955 GN=rxrab PE=2 SV=1
19	Q90416	607	441	0.572	0.692	RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio OX=7955 GN=rxrga PE=2 SV=2
20	Q90417	603	422	0.555	0.701	RXRBB_DANRE Retinoic acid receptor RXR-beta-B OS=Danio rerio OX=7955 GN=rxrbb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.8e-32	124.2	Ligand-binding domain of nuclear hormone receptor
2	PF11825 Nuc_recep-AF1	0.03	25.7	Nuclear/hormone receptor activator site AF-1
3	PF00105 zf-C4	3.2e-28	109.3	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000012407

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000020591	0.989	Retinoic acid receptor, alpha
2	9555.ENSPANP00000006929	0.988	Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proin [...]
3	9555.ENSPANP00000013577	0.984	Peroxisome proliferator-activated receptor alpha
4	9555.ENSPANP00000018069	0.984	Thyroid hormone receptor, beta
5	9555.ENSPANP00000011383	0.981	Nuclear receptor coactivator 2
6	9555.ENSPANP00000001626	0.978	Nuclear receptor subfamily 1, group H, member 2
7	9555.ENSPANP00000012006	0.978	Nuclear receptor subfamily 1, group H, member 3
8	9555.ENSPANP00000001509	0.976	Nuclear receptor coactivator 1
9	9555.ENSPANP00000020576	0.973	Thyroid hormone receptor, alpha
10	9555.ENSPANP00000009803	0.967	Retinoic acid receptor, beta
11	9555.ENSPANP00000012484	0.962	Peroxisome proliferator-activated receptor delta
12	9555.ENSPANP00000019731	0.957	Nuclear receptor corepressor 1
13	9555.ENSPANP00000020534	0.957	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
14	9555.ENSPANP00000004047	0.952	Retinoid X receptor, gamma
15	9555.ENSPANP00000007399	0.929	Vitamin D (1,25- dihydroxyvitamin D3) receptor
16	9555.ENSPANP00000015956	0.929	Nuclear receptor coactivator 3
17	9555.ENSPANP00000003667	0.926	Paired box 8
18	9555.ENSPANP00000013403	0.909	E1A binding protein p300
19	9555.ENSPANP00000013793	0.909	CREB binding protein
20	9555.ENSPANP00000011773	0.907	Nuclear receptor corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	0.995	DNA binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.987	sequence-specific DNA binding
GO:0060089	0.986	molecular transducer activity
GO:0003690	0.986	double-stranded DNA binding
GO:0038023	0.978	signaling receptor activity
GO:1990837	0.978	sequence-specific double-stranded DNA binding
GO:0098531	0.974	ligand-activated transcription factor activity
GO:0004879	0.959	nuclear receptor activity
GO:0001067	0.955	transcription regulatory region nucleic acid binding
GO:0000976	0.953	transcription cis-regulatory region binding
GO:0008134	0.854	transcription factor binding
GO:0061629	0.699	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.499	nuclear receptor binding
GO:0000977	0.356	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.998	regulation of gene expression
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0048518	0.985	positive regulation of biological process
GO:0009893	0.978	positive regulation of metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0006357	0.964	regulation of transcription by RNA polymerase II
GO:0031325	0.952	positive regulation of cellular metabolic process
GO:0051173	0.945	positive regulation of nitrogen compound metabolic process
GO:0009891	0.943	positive regulation of biosynthetic process
GO:0045935	0.942	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.921	cellular process
GO:0051254	0.882	positive regulation of RNA metabolic process
GO:0010557	0.879	positive regulation of macromolecule biosynthetic process
GO:0031328	0.874	positive regulation of cellular biosynthetic process
GO:0045893	0.816	positive regulation of DNA-templated transcription
GO:0050896	0.779	response to stimulus
GO:0045944	0.754	positive regulation of transcription by RNA polymerase II
GO:0032501	0.672	multicellular organismal process
GO:0032502	0.620	developmental process
GO:0051716	0.544	cellular response to stimulus
GO:0008152	0.539	metabolic process
GO:0071704	0.529	organic substance metabolic process
GO:0044238	0.513	primary metabolic process
GO:0048519	0.506	negative regulation of biological process
GO:0044237	0.494	cellular metabolic process
GO:0048523	0.494	negative regulation of cellular process
GO:0048856	0.477	anatomical structure development
GO:0007275	0.451	multicellular organism development
GO:0042221	0.448	response to chemical
GO:0006807	0.392	nitrogen compound metabolic process
GO:0048731	0.375	system development
GO:0043170	0.365	macromolecule metabolic process
GO:0010033	0.342	response to organic substance
GO:0030154	0.328	cell differentiation
GO:0051239	0.322	regulation of multicellular organismal process
GO:0048513	0.320	animal organ development
GO:0009892	0.319	negative regulation of metabolic process
GO:0031324	0.314	negative regulation of cellular metabolic process
GO:0051172	0.304	negative regulation of nitrogen compound metabolic process
GO:0010605	0.304	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.710	cytoplasm
GO:0032991	0.563	protein-containing complex
GO:0005667	0.413	transcription regulator complex
GO:0012505	0.372	endomembrane system
GO:0016020	0.356	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]