StarFunc result for job id P28715

User Input

>input (1186 residues)
MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIK
TAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFF
HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKK
NYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV
AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEE
LESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVH
VGTEAFPISDESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHA
EVLEQQNELCPYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV
ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESESDGSFIEVQSV
ISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESLLRDNSERDDVDGEPQEAEKD
AEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFG
IPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ
KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIRE
FCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVT
CMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKG
KNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKN
GGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28715	0.999	0.999	0.000	1186	1.000	1.000	P28715.pdb.gz	ERCC5_HUMAN DNA excision repair protein ERCC-5 OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3
2	AFDB:P35689	0.419	0.423	0.000	1170	0.678	0.687	P35689.pdb.gz	ERCC5_MOUSE DNA excision repair protein ERCC-5 OS=Mus musculus OX=10090 GN=Ercc5 PE=1 SV=4
3	AFDB:P07276	0.343	0.392	3.261E-40	1031	0.219	0.252	P07276.pdb.gz	RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD2 PE=1 SV=2
4	PDB:1ul1X	0.158	0.560	2.969E-9	313	0.051	0.192	1ul1X.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
5	PDB:1ul1Z	0.159	0.496	3.373E-8	349	0.050	0.169	1ul1Z.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
6	AFDB:Q9W0B0	0.045	0.048	8.840E-3	1107	0.140	0.150	Q9W0B0.pdb.gz	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
7	AFDB:M9PBN6	0.046	0.052	9.093E-2	968	0.133	0.163	M9PBN6.pdb.gz	M9PBN6_DROME Ensconsin, isoform J OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
8	AFDB:F4IZM8	0.039	0.037	1.821E-1	1347	0.110	0.097	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
9	AFDB:M9PE93	0.045	0.053	2.576E-1	1015	0.138	0.162	M9PE93.pdb.gz	M9PE93_DROME Ensconsin, isoform K OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
10	AFDB:E1JJ76	0.045	0.046	3.831E-1	1165	0.120	0.122	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
11	AFDB:Q76NQ1	0.033	0.029	3.831E-1	1429	0.104	0.086	Q76NQ1.pdb.gz	RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster OX=7227 GN=rho-5 PE=2 SV=1
12	AFDB:Q76E23	0.047	0.036	4.446E-1	1727	0.101	0.069	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
13	PDB:2xgjB	0.048	0.065	1.224	777	0.034	0.051	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
14	PDB:7ajuUK	0.041	0.146	2.220	219	0.020	0.110	7ajuUK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mq8SY	0.042	0.142	2.332	238	0.032	0.160	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:2bneB	0.029	0.114	2.451	238	0.008	0.042	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
17	PDB:7ajtUK	0.031	0.129	3.468	242	0.026	0.128	7ajtUK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:4qnwA	0.037	0.107	4.025	369	0.008	0.024	4qnwA.pdb.gz	Structure of an Aspergillus fumigatus old yellow enzyme (EasA) involved in ergot alkaloid biosynthesis.
19	PDB:3milA	0.047	0.187	4.229	240	0.009	0.046	3milA.pdb.gz
20	PDB:3duzA	0.041	0.098	6.289	418	0.020	0.057	3duzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28715	0.0	2440	1186	1.000	1.000	ERCC5_HUMAN DNA excision repair protein ERCC-5 OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3
2	P35689	0.0	1451	1170	0.679	0.688	ERCC5_MOUSE DNA excision repair protein ERCC-5 OS=Mus musculus OX=10090 GN=Ercc5 PE=1 SV=4
3	Q4U2Q5	3.46e-75	275	1236	0.113	0.108	Q4U2Q5_DROME FI23547p1 OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
4	Q4U2Q3	3.97e-75	275	1236	0.113	0.108	Q4U2Q3_DROME XPG OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
5	Q4U2Q2	6.85e-75	274	1257	0.113	0.107	Q4U2Q2_DROME XPG variant OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
6	Q9I7N6	4.37e-74	271	1236	0.111	0.107	Q9I7N6_DROME DNA repair endonuclease OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=2
7	Q4U2H8	2.82e-72	248	378	0.104	0.325	Q4U2H8_DROME Nucleotide excision repair protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
8	Q9ATY5	2.51e-64	242	1479	0.111	0.089	UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana OX=3702 GN=UVH3 PE=2 SV=1
9	P28706	2.50e-61	231	1112	0.108	0.115	RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad13 PE=2 SV=2
10	Q6AWP2	5.31e-53	204	932	0.098	0.124	Q6AWP2_DROME RE62451p OS=Drosophila melanogaster OX=7227 GN=mus201 PE=2 SV=1
11	A0A1D8PLU8	1.22e-51	200	990	0.099	0.119	A0A1D8PLU8_CANAL SsDNA endodeoxyribonuclease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD2 PE=3 SV=1
12	P07276	1.46e-48	191	1031	0.090	0.104	RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD2 PE=1 SV=2
13	Q17RS7	6.65e-21	101	908	0.044	0.057	GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens OX=9606 GN=GEN1 PE=1 SV=2
14	Q38DL8	5.41e-19	95.5	746	0.060	0.095	Q38DL8_TRYB2 DNA repair protein RAD2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2870 PE=3 SV=1
15	Q9M2Z3	2.90e-17	89.4	600	0.059	0.117	GENL2_ARATH Single-strand DNA endonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SEND1 PE=1 SV=2
16	Q22418	8.23e-17	86.7	434	0.067	0.182	Q22418_CAEEL GEN1 Holliday junction resolvase homolog OS=Caenorhabditis elegans OX=6239 GN=gen-1 PE=4 SV=1
17	Q9N3T2	8.26e-15	80.1	382	0.063	0.196	FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=crn-1 PE=1 SV=1
18	Q6TNU4	9.81e-15	79.7	380	0.059	0.184	FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio OX=7955 GN=fen1 PE=2 SV=1
19	P26793	2.00e-14	79.0	382	0.067	0.207	FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD27 PE=1 SV=1
20	Q9SXQ6	6.75e-14	77.4	380	0.052	0.163	FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica OX=39947 GN=FEN1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01367 5_3_exonuc	33	16.5	5'-3' exonuclease, C-terminal SAM fold
2	PF07299 EF-G-binding_N	1.3e+02	14.5	Elongation factor G-binding protein, N-terminal
3	PF08665 PglZ	3.9e+02	12.5	PglZ domain
4	PF00867 XPG_I	1.9e-20	84.4	XPG I-region
5	PF00752 XPG_N	1.7e-31	120.0	XPG N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310520	0.995	DNA repair endonuclease XPF
2	9606.ENSP00000013807	0.994	DNA excision repair protein ERCC-1
3	9606.ENSP00000285398	0.991	TFIIH basal transcription factor complex helicase XPB subunit
4	9606.ENSP00000265963	0.988	General transcription factor IIH subunit 1
5	9606.ENSP00000375809	0.984	TFIIH basal transcription factor complex helicase XPD subunit
6	9606.ENSP00000265038	0.981	DNA excision repair protein ERCC-8
7	9606.ENSP00000484288	0.979	DNA ligase 4
8	9606.ENSP00000233146	0.978	DNA mismatch repair protein Msh2
9	9606.ENSP00000350708	0.978	UV excision repair protein RAD23 homolog B
10	9606.ENSP00000364270	0.978	DNA repair protein complementing XP-A cells
11	9606.ENSP00000234420	0.975	DNA mismatch repair protein Msh6
12	9606.ENSP00000375978	0.975	X-ray repair cross-complementing protein 5
13	9606.ENSP00000285021	0.967	DNA repair protein complementing XP-C cells
14	9606.ENSP00000352257	0.964	X-ray repair cross-complementing protein 6
15	9606.ENSP00000278616	0.962	Serine-protein kinase ATM
16	9606.ENSP00000406046	0.961	DNA polymerase delta catalytic subunit
17	9606.ENSP00000367527	0.955	Protein artemis
18	9606.ENSP00000348089	0.952	DNA excision repair protein ERCC-6
19	9606.ENSP00000421491	0.947	DNA repair protein XRCC4
20	9606.ENSP00000313420	0.944	DNA-dependent protein kinase catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000217	1.000	DNA secondary structure binding
GO:0004520	1.000	DNA endonuclease activity
GO:0003697	0.998	single-stranded DNA binding
GO:0003684	0.998	damaged DNA binding
GO:0044877	0.996	protein-containing complex binding
GO:0042803	0.996	protein homodimerization activity
GO:0008047	0.995	enzyme activator activity
GO:0003690	0.995	double-stranded DNA binding
GO:0000993	0.995	RNA polymerase II complex binding
GO:0000405	0.949	bubble DNA binding
GO:0048256	0.396	flap endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006281	0.999	DNA repair
GO:0009411	0.978	response to UV
GO:0006289	0.966	nucleotide-excision repair
GO:0065007	0.911	biological regulation
GO:0050794	0.849	regulation of cellular process
GO:0006302	0.802	double-strand break repair
GO:0048519	0.655	negative regulation of biological process
GO:0048523	0.653	negative regulation of cellular process
GO:0006310	0.426	DNA recombination
GO:0065009	0.335	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0005657	0.995	replication fork
GO:0000228	0.995	nuclear chromosome
GO:0000109	0.993	nucleotide-excision repair complex
GO:0005662	0.989	DNA replication factor A complex
GO:0140535	0.342	intracellular protein-containing complex
GO:1990234	0.340	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]