StarFunc result for job id P28749

User Input

>input (1068 residues)
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28749	1.000	1.000	0.000	1068	1.000	1.000	P28749.pdb.gz	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
2	AFDB:Q08999	0.722	0.680	2.399E-87	1139	0.522	0.490	Q08999.pdb.gz	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
3	AFDB:F4HRS2	0.069	0.044	2.485E-3	2222	0.100	0.048	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
4	AFDB:D3ZEY0	0.058	0.044	4.018E-3	1530	0.099	0.069	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
5	AFDB:Q9DBD5	0.095	0.093	4.580E-3	1123	0.157	0.150	Q9DBD5.pdb.gz	PELP1_MOUSE Proline-, glutamic acid- and leucine-rich protein 1 OS=Mus musculus OX=10090 GN=Pelp1 PE=1 SV=2
6	AFDB:Q961B0	0.078	0.077	2.023E-2	1067	0.113	0.113	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
7	AFDB:F4IAT2	0.069	0.049	3.417E-2	1823	0.126	0.074	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
8	AFDB:P50275	0.054	0.062	4.251E-2	885	0.116	0.140	P50275.pdb.gz	ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASE1 PE=1 SV=1
9	AFDB:Q17R89	0.079	0.093	6.875E-2	818	0.125	0.164	Q17R89.pdb.gz	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
10	AFDB:Q9CXB8	0.087	0.080	7.182E-2	1231	0.123	0.106	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
11	PDB:7zs9M	0.102	0.288	9.520E-2	310	0.026	0.090	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	PDB:6eu0Z	0.101	0.286	1.539E-1	339	0.035	0.109	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
13	PDB:7qe7A	0.068	0.054	4.589E-1	1648	0.060	0.039	7qe7A.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:5hbhB	0.077	0.289	5.709E-1	270	0.036	0.141	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
15	PDB:6fvtN	0.081	0.089	6.799E-1	922	0.057	0.066	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
16	PDB:6ahoA	0.068	0.075	8.459E-1	916	0.070	0.082	6ahoA.pdb.gz
17	PDB:6swy8	0.044	0.101	9.232E-1	325	0.026	0.086	6swy8.pdb.gz
18	PDB:3g33B	0.083	0.354	1.007	229	0.023	0.109	3g33B.pdb.gz
19	PDB:7kueB	0.081	0.342	1.099	225	0.025	0.120	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
20	PDB:7nj0C	0.082	0.296	1.149	270	0.018	0.070	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55081	0.0	1054	1135	0.516	0.485	RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus norvegicus OX=10116 GN=Rbl2 PE=1 SV=1
2	P28749	0.0	2227	1068	1.000	1.000	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
3	Q08999	0.0	1078	1139	0.524	0.492	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
4	Q64700	0.0	1049	1135	0.511	0.481	RBL2_MOUSE Retinoblastoma-like protein 2 OS=Mus musculus OX=10090 GN=Rbl2 PE=1 SV=3
5	Q64701	0.0	1990	1063	0.904	0.909	RBL1_MOUSE Retinoblastoma-like protein 1 OS=Mus musculus OX=10090 GN=Rbl1 PE=1 SV=3
6	H0YE05	2.04e-164	486	254	0.232	0.976	H0YE05_HUMAN RB transcriptional corepressor like 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=8
7	Q24472	1.47e-93	319	845	0.192	0.243	RBF_DROME Retinoblastoma family protein OS=Drosophila melanogaster OX=7227 GN=Rbf PE=1 SV=2
8	Q9YGE5	1.29e-51	199	910	0.148	0.174	Q9YGE5_ONCMY Retinoblastoma 1 OS=Oncorhynchus mykiss OX=8022 GN=RB1 PE=2 SV=1
9	A0JMQ4	2.49e-48	189	903	0.156	0.185	A0JMQ4_DANRE Retinoblastoma 1 OS=Danio rerio OX=7955 GN=zgc:154147 PE=1 SV=1
10	P33568	2.76e-48	189	920	0.154	0.179	RB_RAT Retinoblastoma-associated protein OS=Rattus norvegicus OX=10116 GN=Rb1 PE=1 SV=3
11	P13405	8.35e-48	187	921	0.153	0.177	RB_MOUSE Retinoblastoma-associated protein OS=Mus musculus OX=10090 GN=Rb1 PE=1 SV=2
12	A0A0D9RYS3	7.06e-47	184	928	0.148	0.170	A0A0D9RYS3_CHLSB RB transcriptional corepressor 1 OS=Chlorocebus sabaeus OX=60711 GN=RB1 PE=3 SV=1
13	P06400	2.85e-46	182	928	0.160	0.184	RB_HUMAN Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2
14	G5EDT1	1.78e-34	145	961	0.144	0.160	LIN35_CAEEL Retinoblastoma-like protein homolog lin-35 OS=Caenorhabditis elegans OX=6239 GN=lin-35 PE=1 SV=1
15	Q66WV0	1.44e-33	142	1003	0.135	0.144	RBR1_NICBE Retinoblastoma-related protein 1 OS=Nicotiana benthamiana OX=4100 GN=RBR1 PE=2 SV=1
16	Q9NIS1	1.37e-30	132	782	0.141	0.193	Q9NIS1_DROME RB-related protein RBF2 OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=3 SV=1
17	Q9VF04	1.97e-30	131	783	0.140	0.192	Q9VF04_DROME RE32990p OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=2 SV=1
18	Q9LKZ3	2.01e-27	122	1013	0.145	0.153	RBR1_ARATH Retinoblastoma-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBR1 PE=1 SV=1
19	Q54FX2	3.31e-12	73.6	1312	0.036	0.029	RBLA_DICDI Retinoblastoma-like protein A OS=Dictyostelium discoideum OX=44689 GN=rblA PE=2 SV=1
20	V6CLK4	0.49	37.0	855	0.023	0.029	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07737 ATLF	25	15.6	Anthrax toxin lethal factor, N- and C-terminal domain
2	PF11934 DUF3452	1.7e-45	165.4	Domain of unknown function (DUF3452)
3	PF01858 RB_A	1.5e-73	258.4	Retinoblastoma-associated protein A domain
4	PF01857 RB_B	9.8e-51	182.6	Retinoblastoma-associated protein B domain
5	PF08934 Rb_C	0.019	26.2	Rb C-terminal domain
6	PF00382 TFIIB	6.2	18.2	Transcription factor TFIIB repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262904	0.999	Transcription factor E2F3
2	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
3	9606.ENSP00000274026	0.999	Cyclin-A2
4	9606.ENSP00000345571	0.999	Transcription factor E2F1
5	9606.ENSP00000368686	0.999	Transcription factor E2F4
6	9606.ENSP00000398124	0.999	Transcription factor E2F5
7	9606.ENSP00000362649	0.998	Histone deacetylase 1
8	9606.ENSP00000451812	0.998	Protein lin-52 homolog
9	9606.ENSP00000329102	0.996	Protein lin-9 homolog
10	9606.ENSP00000364519	0.996	Transcription factor Dp-1
11	9606.ENSP00000217026	0.995	Myb-related protein B
12	9606.ENSP00000332973	0.995	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000479618	0.995	Myc proto-oncogene protein
14	9606.ENSP00000341947	0.994	Protein lin-54 homolog
15	9606.ENSP00000257904	0.992	Cyclin-dependent kinase 4
16	9606.ENSP00000362592	0.990	Histone-binding protein RBBP4
17	9606.ENSP00000355249	0.986	Transcription factor E2F2
18	9606.ENSP00000301159	0.984	Protein lin-37 homolog
19	9606.ENSP00000227507	0.980	G1/S-specific cyclin-D1
20	9606.ENSP00000265734	0.979	Cyclin-dependent kinase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990841	0.999	promoter-specific chromatin binding
GO:1901363	0.699	heterocyclic compound binding
GO:0097159	0.696	organic cyclic compound binding
GO:0003676	0.672	nucleic acid binding
GO:0003677	0.618	DNA binding
GO:0008134	0.423	transcription factor binding
GO:0003690	0.397	double-stranded DNA binding
GO:1990837	0.360	sequence-specific double-stranded DNA binding
GO:0140297	0.339	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0048523	0.984	negative regulation of cellular process
GO:0010468	0.982	regulation of gene expression
GO:0010605	0.982	negative regulation of macromolecule metabolic process
GO:0031324	0.925	negative regulation of cellular metabolic process
GO:0065009	0.924	regulation of molecular function
GO:0080090	0.912	regulation of primary metabolic process
GO:0019219	0.865	regulation of nucleobase-containing compound metabolic process
GO:0019220	0.836	regulation of phosphate metabolic process
GO:0051338	0.824	regulation of transferase activity
GO:0043549	0.809	regulation of kinase activity
GO:0010556	0.794	regulation of macromolecule biosynthetic process
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0051252	0.756	regulation of RNA metabolic process
GO:0006355	0.745	regulation of DNA-templated transcription
GO:0043550	0.658	regulation of lipid kinase activity
GO:0006357	0.644	regulation of transcription by RNA polymerase II
GO:2000772	0.617	regulation of cellular senescence
GO:0010629	0.616	negative regulation of gene expression
GO:0051172	0.612	negative regulation of nitrogen compound metabolic process
GO:0045934	0.535	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.515	negative regulation of biosynthetic process
GO:0031327	0.473	negative regulation of cellular biosynthetic process
GO:0010558	0.472	negative regulation of macromolecule biosynthetic process
GO:0009987	0.428	cellular process
GO:0071704	0.340	organic substance metabolic process
GO:0051253	0.340	negative regulation of RNA metabolic process
GO:0045892	0.334	negative regulation of DNA-templated transcription
GO:0048518	0.316	positive regulation of biological process
GO:0000122	0.302	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0043232	0.690	intracellular non-membrane-bounded organelle
GO:0005667	0.672	transcription regulator complex
GO:0005737	0.605	cytoplasm
GO:0005829	0.354	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]