StarFunc result for job id P28799

User Input

>input (593 residues)
MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGP
CQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNS
VGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT
PTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCC
SDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQ
SGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
KRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQH
CCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQG
WACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28799	1.000	1.000	0.000	593	1.000	1.000	P28799.pdb.gz	GRN_HUMAN Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2
2	AFDB:P23785	0.467	0.469	2.311E-83	588	0.752	0.759	P23785.pdb.gz	GRN_RAT Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3
3	AFDB:P28798	0.486	0.489	1.590E-82	589	0.750	0.756	P28798.pdb.gz	GRN_MOUSE Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2
4	AFDB:K7EQ05	0.190	0.244	2.602E-66	436	0.734	0.998	K7EQ05.pdb.gz	K7EQ05_HUMAN Granulin precursor OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=1
5	AFDB:F1R6I2	0.233	0.194	3.615E-53	729	0.415	0.337	F1R6I2.pdb.gz	F1R6I2_DANRE Granulin b OS=Danio rerio OX=7955 GN=fj14b08 PE=3 SV=1
6	AFDB:E9QI45	0.191	0.121	4.284E-52	1049	0.398	0.225	E9QI45.pdb.gz	E9QI45_DANRE Granulin a OS=Danio rerio OX=7955 GN=grna PE=1 SV=1
7	AFDB:E9QCA6	0.166	0.120	2.191E-51	873	0.386	0.262	E9QCA6.pdb.gz
8	PDB:8a7eC	0.067	0.039	3.716E-2	1524	0.099	0.039	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
9	AFDB:Q5A1E0	0.070	0.044	8.882E-2	1308	0.093	0.042	Q5A1E0.pdb.gz	IFF5_CANAL Cell wall protein IFF5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF5 PE=1 SV=1
10	PDB:6jztA	0.048	0.065	1.344E-1	402	0.083	0.122	6jztA.pdb.gz
11	AFDB:P08640	0.066	0.037	2.636E-1	1367	0.110	0.048	P08640.pdb.gz	FLO11_YEAST Flocculation protein FLO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO11 PE=1 SV=2
12	AFDB:Q2Q0I9	0.073	0.036	2.636E-1	1779	0.078	0.026	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
13	PDB:8a7dQ	0.055	0.089	3.274E-1	273	0.062	0.136	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
14	PDB:6q6hA	0.066	0.039	3.440E-1	1551	0.057	0.022	6q6hA.pdb.gz	Cyclin A2 degradation during the spindle assembly checkpoint requires multiple binding modes to the APC/C.
15	PDB:5nnzA	0.066	0.098	5.926E-1	335	0.066	0.116	5nnzA.pdb.gz
16	PDB:7r5jN0	0.061	0.083	6.542E-1	301	0.069	0.136	7r5jN0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7qe7A	0.076	0.042	6.873E-1	1648	0.064	0.023	7qe7A.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:3t5oA	0.050	0.043	7.222E-1	871	0.084	0.057	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:1haqA	0.054	0.038	1.184	1213	0.108	0.053	1haqA.pdb.gz
20	PDB:5wyjBA	0.067	0.061	1.307	755	0.086	0.068	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKL3	0.0	719	388	0.609	0.930	K7EKL3_HUMAN Granulin precursor (Fragment) OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=1
2	K7EQ05	0.0	621	436	0.560	0.761	K7EQ05_HUMAN Granulin precursor OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=1
3	P23785	0.0	902	588	0.754	0.760	GRN_RAT Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3
4	P28798	0.0	907	589	0.752	0.757	GRN_MOUSE Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2
5	P28799	0.0	1179	593	1.000	1.000	GRN_HUMAN Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2
6	F1R6I2	1.50e-132	406	729	0.411	0.335	F1R6I2_DANRE Granulin b OS=Danio rerio OX=7955 GN=fj14b08 PE=3 SV=1
7	Q7T3M4	3.03e-131	402	729	0.403	0.328	Q7T3M4_DANRE Granulins precursor OS=Danio rerio OX=7955 GN=wu:fj14b08 PE=2 SV=1
8	E9QI45	3.36e-120	382	1049	0.410	0.232	E9QI45_DANRE Granulin a OS=Danio rerio OX=7955 GN=grna PE=1 SV=1
9	Q8QGN9	3.01e-115	365	873	0.374	0.254	Q8QGN9_DANRE Granulin-A OS=Danio rerio OX=7955 GN=grna PE=1 SV=3
10	P43297	8.44e-06	50.8	462	0.051	0.065	RD21A_ARATH Cysteine proteinase RD21A OS=Arabidopsis thaliana OX=3702 GN=RD21A PE=1 SV=1
11	Q9FMH8	1.40e-05	50.1	463	0.051	0.065	RD21B_ARATH Probable cysteine protease RD21B OS=Arabidopsis thaliana OX=3702 GN=RD21B PE=1 SV=1
12	B2LSD2	1.88e-05	49.7	430	0.052	0.072	MUCIN_MUCPR Cysteine proteinase mucunain (Fragment) OS=Mucuna pruriens OX=157652 GN=MUCUNAIN PE=1 SV=2
13	Q7XR52	2.91e-05	49.3	490	0.046	0.055	CYSP1_ORYSJ Cysteine protease 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CP1 PE=2 SV=2
14	Q9LT78	0.001	43.9	452	0.047	0.062	RD21C_ARATH Probable cysteine protease RD21C OS=Arabidopsis thaliana OX=3702 GN=RD21C PE=1 SV=1
15	Q0WVJ5	0.002	43.5	437	0.039	0.053	Q0WVJ5_ARATH At1g09850 OS=Arabidopsis thaliana OX=3702 GN=XBCP3 PE=1 SV=1
16	T2BRA8	0.082	38.1	505	0.039	0.046	T2BRA8_TOBAC Cysteine protease CP14 OS=Nicotiana tabacum OX=4097 GN=CP14 PE=1 SV=1
17	O88277	0.15	37.7	4351	0.046	0.006	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
18	Q9NYQ8	0.33	36.6	4349	0.044	0.006	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
19	Q8BNA6	0.95	35.0	4555	0.056	0.007	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
20	Q9EPX2	1.5	34.3	1280	0.057	0.027	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00396 Granulin	1.7e-92	314.6	Granulin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000053867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256637	0.994	Sortilin
2	9606.ENSP00000162749	0.993	Tumor necrosis factor receptor superfamily member 1A
3	9606.ENSP00000363827	0.992	Basement membrane-specific heparan sulfate proteoglycan core protein
4	9606.ENSP00000378394	0.962	Prosaposin
5	9606.ENSP00000351209	0.942	Ephrin type-A receptor 2
6	9606.ENSP00000302961	0.939	Heat shock protein family A member 4
7	9606.ENSP00000236671	0.911	Cathepsin D
8	9606.ENSP00000365435	0.897	Tumor necrosis factor receptor superfamily member 1B
9	9606.ENSP00000261900	0.895	Cyclin-T1
10	9606.ENSP00000342082	0.882	Antileukoproteinase
11	9606.ENSP00000333938	0.875	Nexilin
12	9606.ENSP00000482753	0.865	Guanine nucleotide exchange C9orf72
13	9606.ENSP00000340820	0.855	Microtubule-associated protein tau
14	9606.ENSP00000353874	0.853	Toll-like receptor 9
15	9606.ENSP00000240185	0.845	TAR DNA-binding protein 43
16	9606.ENSP00000234590	0.816	Alpha-enolase
17	9606.ENSP00000263780	0.806	Charged multivesicular body protein 2b
18	9606.ENSP00000367013	0.799	Tumor necrosis factor receptor superfamily member 25
19	9606.ENSP00000379901	0.785	Transmembrane protein 106B
20	9606.ENSP00000232501	0.769	GATOR complex protein NPRL2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.951	organic cyclic compound binding
GO:1901363	0.923	heterocyclic compound binding
GO:0003676	0.905	nucleic acid binding
GO:0005102	0.882	signaling receptor binding
GO:0098772	0.806	molecular function regulator activity
GO:0003723	0.772	RNA binding
GO:0140677	0.747	molecular function activator activity
GO:0030546	0.733	signaling receptor activator activity
GO:0048018	0.720	receptor ligand activity
GO:0051087	0.713	chaperone binding
GO:0008083	0.708	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.980	regulation of biological process
GO:0016043	0.978	cellular component organization
GO:0050794	0.974	regulation of cellular process
GO:0008152	0.964	metabolic process
GO:0019222	0.964	regulation of metabolic process
GO:0032501	0.961	multicellular organismal process
GO:0051179	0.939	localization
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0080090	0.927	regulation of primary metabolic process
GO:0030162	0.919	regulation of proteolysis
GO:0051336	0.917	regulation of hydrolase activity
GO:0050896	0.907	response to stimulus
GO:0031347	0.906	regulation of defense response
GO:0051241	0.903	negative regulation of multicellular organismal process
GO:0040012	0.898	regulation of locomotion
GO:0051641	0.896	cellular localization
GO:0002683	0.879	negative regulation of immune system process
GO:0051130	0.876	positive regulation of cellular component organization
GO:0050777	0.868	negative regulation of immune response
GO:0071704	0.856	organic substance metabolic process
GO:0032101	0.850	regulation of response to external stimulus
GO:2000145	0.806	regulation of cell motility
GO:0002831	0.805	regulation of response to biotic stimulus
GO:0043085	0.802	positive regulation of catalytic activity
GO:0030334	0.791	regulation of cell migration
GO:0051247	0.779	positive regulation of protein metabolic process
GO:0032502	0.773	developmental process
GO:0051649	0.761	establishment of localization in cell
GO:0006810	0.751	transport
GO:0048523	0.750	negative regulation of cellular process
GO:0042981	0.743	regulation of apoptotic process
GO:0050793	0.732	regulation of developmental process
GO:0051345	0.725	positive regulation of hydrolase activity
GO:0050865	0.723	regulation of cell activation
GO:0042127	0.720	regulation of cell population proliferation
GO:0052547	0.708	regulation of peptidase activity
GO:0044238	0.704	primary metabolic process
GO:0048584	0.702	positive regulation of response to stimulus
GO:0007041	0.694	lysosomal transport
GO:0045862	0.691	positive regulation of proteolysis
GO:0032102	0.690	negative regulation of response to external stimulus
GO:0033043	0.689	regulation of organelle organization
GO:0050727	0.663	regulation of inflammatory response
GO:0065008	0.641	regulation of biological quality
GO:1901214	0.626	regulation of neuron death
GO:0050678	0.622	regulation of epithelial cell proliferation
GO:0007040	0.620	lysosome organization
GO:0048856	0.615	anatomical structure development
GO:0044088	0.605	regulation of vacuole organization
GO:0008284	0.596	positive regulation of cell population proliferation
GO:2000147	0.586	positive regulation of cell motility
GO:0010952	0.586	positive regulation of peptidase activity
GO:0051240	0.575	positive regulation of multicellular organismal process
GO:0006807	0.571	nitrogen compound metabolic process
GO:0031348	0.568	negative regulation of defense response
GO:0050728	0.556	negative regulation of inflammatory response
GO:0002694	0.550	regulation of leukocyte activation
GO:0002697	0.543	regulation of immune effector process
GO:0031323	0.535	regulation of cellular metabolic process
GO:0007275	0.530	multicellular organism development
GO:0006950	0.529	response to stress
GO:0050679	0.519	positive regulation of epithelial cell proliferation
GO:0030154	0.508	cell differentiation
GO:0008283	0.505	cell population proliferation
GO:0007399	0.501	nervous system development
GO:0042592	0.499	homeostatic process
GO:0009892	0.496	negative regulation of metabolic process
GO:0048468	0.496	cell development
GO:0050866	0.495	negative regulation of cell activation
GO:0045088	0.492	regulation of innate immune response
GO:0002695	0.487	negative regulation of leukocyte activation
GO:0022008	0.480	neurogenesis
GO:0045824	0.472	negative regulation of innate immune response
GO:1901564	0.468	organonitrogen compound metabolic process
GO:0016192	0.466	vesicle-mediated transport
GO:0042221	0.448	response to chemical
GO:0019725	0.442	cellular homeostasis
GO:0031325	0.440	positive regulation of cellular metabolic process
GO:0048878	0.439	chemical homeostasis
GO:0044237	0.435	cellular metabolic process
GO:0043170	0.423	macromolecule metabolic process
GO:0050801	0.418	monoatomic ion homeostasis
GO:0009653	0.408	anatomical structure morphogenesis
GO:0051094	0.408	positive regulation of developmental process
GO:0006885	0.406	regulation of pH
GO:0030335	0.389	positive regulation of cell migration
GO:0010468	0.386	regulation of gene expression
GO:0051716	0.379	cellular response to stimulus
GO:0040007	0.361	growth
GO:0048699	0.356	generation of neurons
GO:0030003	0.355	intracellular monoatomic cation homeostasis
GO:0048589	0.353	developmental growth
GO:0019538	0.347	protein metabolic process
GO:0010605	0.307	negative regulation of macromolecule metabolic process
GO:0030030	0.302	cell projection organization
GO:0030182	0.300	neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	0.999	vesicle
GO:0012505	0.998	endomembrane system
GO:0005764	0.997	lysosome
GO:0031410	0.993	cytoplasmic vesicle
GO:0005768	0.984	endosome
GO:0005576	0.941	extracellular region
GO:0005615	0.896	extracellular space
GO:0016020	0.888	membrane
GO:0070013	0.861	intracellular organelle lumen
GO:0005783	0.750	endoplasmic reticulum
GO:1903561	0.700	extracellular vesicle
GO:0070062	0.694	extracellular exosome
GO:0005794	0.662	Golgi apparatus
GO:0071944	0.653	cell periphery
GO:0005886	0.638	plasma membrane
GO:0099503	0.633	secretory vesicle
GO:0030141	0.598	secretory granule
GO:0031090	0.585	organelle membrane
GO:0098588	0.557	bounding membrane of organelle
GO:0031981	0.334	nuclear lumen
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]