StarFunc result for job id P28827

User Input

>input (1452 residues)
MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED
LPGAVPTESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYID
GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYK
DIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQV
KSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQT
EEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLE
EDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNG
GEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKF
CYEVALEYLNSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AUH1	0.860	0.864	0.000	1446	0.521	0.523	B1AUH1.pdb.gz	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
2	AFDB:B3DK56	0.529	0.531	0.000	1444	0.517	0.519	B3DK56.pdb.gz	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
3	AFDB:F1LXJ9	0.410	0.468	0.000	1269	0.596	0.682	F1LXJ9.pdb.gz	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
4	AFDB:P28827	1.000	1.000	0.000	1452	1.000	1.000	P28827.pdb.gz	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
5	AFDB:P35822	0.719	0.717	0.000	1457	0.615	0.613	P35822.pdb.gz	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
6	AFDB:A0A0H2UKT5	0.386	0.294	7.841E-93	1914	0.286	0.217	A0A0H2UKT5.pdb.gz
7	AFDB:P23468	0.389	0.296	1.663E-92	1912	0.290	0.220	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
8	AFDB:Q13332	0.407	0.306	4.107E-91	1948	0.287	0.214	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
9	AFDB:A4IFW2	0.398	0.303	6.133E-91	1909	0.280	0.213	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
10	AFDB:B0V2N1	0.386	0.295	6.813E-89	1907	0.278	0.211	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
11	PDB:4gwfA	0.179	0.515	8.619E-25	497	0.079	0.229	4gwfA.pdb.gz
12	PDB:5xzrA	0.178	0.491	1.164E-24	519	0.079	0.222	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:3ps5A	0.185	0.496	4.074E-24	529	0.078	0.214	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:6krwA	0.176	0.789	1.945E-19	306	0.053	0.252	6krwA.pdb.gz
15	PDB:3m4uA	0.158	0.735	9.263E-16	285	0.055	0.281	3m4uA.pdb.gz
16	PDB:7q5zA	0.078	0.083	1.140E-12	1344	0.055	0.060	7q5zA.pdb.gz
17	PDB:8eyyA	0.154	0.266	1.882E-12	775	0.044	0.083	8eyyA.pdb.gz
18	PDB:5oj2B	0.101	0.180	4.411E-12	692	0.057	0.120	5oj2B.pdb.gz
19	PDB:7q1yA	0.078	0.082	1.263E-11	1374	0.061	0.065	7q1yA.pdb.gz
20	PDB:6pxvA	0.156	0.255	1.397E-11	823	0.041	0.072	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H0	0.0	1563	1430	0.526	0.534	A0A0G2K3H0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
2	A0A8I5ZW41	0.0	1954	1465	0.654	0.648	A0A8I5ZW41_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
3	A0A8I6AFL3	0.0	1961	1455	0.654	0.653	A0A8I6AFL3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
4	A5HV10	0.0	1029	709	0.346	0.708	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
5	A5I9F0	0.0	1828	1439	0.608	0.614	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
6	B1AUH1	0.0	1580	1446	0.528	0.530	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
7	B3DK56	0.0	1527	1444	0.530	0.533	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
8	E7EPS8	0.0	2915	1390	0.957	1.000	E7EPS8_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
9	E9PGC5	0.0	1845	1472	0.615	0.607	E9PGC5_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
10	F1LXJ9	0.0	1961	1454	0.654	0.653	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
11	F1MAG7	0.0	1516	1380	0.515	0.542	F1MAG7_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
12	O14522	0.0	1967	1441	0.649	0.654	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
13	P28827	0.0	3049	1452	1.000	1.000	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
14	P28828	0.0	2981	1452	0.975	0.975	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2
15	P35822	0.0	1831	1457	0.613	0.611	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
16	Q15262	0.0	1828	1439	0.610	0.615	PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=2
17	Q5TG12	0.0	1831	1458	0.614	0.611	Q5TG12_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
18	Q92729	0.0	1581	1446	0.531	0.533	PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU PE=1 SV=2
19	Q99M80	0.0	1966	1454	0.656	0.655	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
20	Q9WUL3	6.98e-170	520	502	0.171	0.494	Q9WUL3_RAT Receptor-like protein tyrosine phosphatase kappa extracellular region OS=Rattus norvegicus OX=10116 GN=RPTPK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14828 Amnionless	3.6e+02	11.3	Amnionless
2	PF06808 DctM	2.4e+02	12.0	Tripartite ATP-independent periplasmic transporter, DctM component
3	PF00782 DSPc	6.9e-05	34.1	Dual specificity phosphatase, catalytic domain
4	PF19904 DUF6377	6.9e+02	11.2	Domain of unknown function (DUF6377)
5	PF06103 DUF948	3.9e+02	12.7	Bacterial protein of unknown function (DUF948)
6	PF15820 ECSCR	9.5	17.5	Endothelial cell-specific chemotaxis regulator
7	PF14575 EphA2_TM	72	15.6	Ephrin type-A receptor 2 transmembrane domain
8	PF00041 fn3	1.6e-23	94.2	Fibronectin type III domain
9	PF07679 I-set	0.32	22.4	Immunoglobulin I-set domain
10	PF00047 ig	5.3e-09	47.5	Immunoglobulin domain
11	PF13895 Ig_2	24	16.6	Immunoglobulin domain
12	PF13927 Ig_3	0.67	21.9	Immunoglobulin domain
13	PF00629 MAM	2.2e-29	113.8	MAM domain, meprin/A5/mu
14	PF14566 PTPlike_phytase	1.4	20.5	Inositol hexakisphosphate
15	PF18861 PTP_tm	0.53	22.0	TM proximal of protein tyrosine phosphatase, receptor type J
16	PF16656 Pur_ac_phosph_N	4.7	19.2	Purple acid Phosphatase, N-terminal domain
17	PF00102 Y_phosphatase	6.8e-146	495.6	Protein-tyrosine phosphatase
18	PF13350 Y_phosphatase3	0.29	22.7	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.955	Catenin beta-1
2	9606.ENSP00000382004	0.943	Catenin delta-1
3	9606.ENSP00000418070	0.907	Nectin-3
4	9606.ENSP00000466363	0.904	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
5	9606.ENSP00000375960	0.903	Afadin
6	9606.ENSP00000426909	0.841	Receptor of activated protein C kinase 1
7	9606.ENSP00000282561	0.832	Gap junction alpha-1 protein
8	9606.ENSP00000261769	0.744	Cadherin-1
9	9606.ENSP00000027335	0.737	Cadherin-17
10	9606.ENSP00000369325	0.731	Cyclin-dependent kinase-like 5
11	9606.ENSP00000391167	0.677	C-myc promoter-binding protein
12	9606.ENSP00000280362	0.670	6-pyruvoyl tetrahydrobiopterin synthase
13	9606.ENSP00000381007	0.669	Neuron navigator 3
14	9606.ENSP00000328088	0.654	PRKC apoptosis WT1 regulator protein
15	9606.ENSP00000323246	0.636	Transcription factor E2F7
16	9606.ENSP00000363667	0.617	Tyrosine-protein phosphatase non-receptor type 3
17	9606.ENSP00000372959	0.606	Leucine-rich repeat-containing protein 30
18	9606.ENSP00000349932	0.593	Receptor-type tyrosine-protein phosphatase S
19	9606.ENSP00000352513	0.586	Myelin protein zero-like protein 1
20	9606.ENSP00000379396	0.579	Neuron navigator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0050839	0.979	cell adhesion molecule binding
GO:0045296	0.968	cadherin binding
GO:0019198	0.967	transmembrane receptor protein phosphatase activity
GO:0005001	0.963	transmembrane receptor protein tyrosine phosphatase activity
GO:0042802	0.665	identical protein binding
GO:0008013	0.473	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0032502	0.946	developmental process
GO:0032501	0.942	multicellular organismal process
GO:0050896	0.938	response to stimulus
GO:0048856	0.924	anatomical structure development
GO:0071704	0.840	organic substance metabolic process
GO:0044237	0.829	cellular metabolic process
GO:0065008	0.827	regulation of biological quality
GO:0044238	0.825	primary metabolic process
GO:0048519	0.799	negative regulation of biological process
GO:0006807	0.793	nitrogen compound metabolic process
GO:0043170	0.772	macromolecule metabolic process
GO:0007275	0.772	multicellular organism development
GO:0003013	0.770	circulatory system process
GO:0006796	0.754	phosphate-containing compound metabolic process
GO:0071840	0.726	cellular component organization or biogenesis
GO:0035150	0.718	regulation of tube size
GO:0016043	0.716	cellular component organization
GO:0003018	0.714	vascular process in circulatory system
GO:0008015	0.697	blood circulation
GO:0043412	0.689	macromolecule modification
GO:1901564	0.688	organonitrogen compound metabolic process
GO:0035296	0.674	regulation of tube diameter
GO:0007155	0.661	cell adhesion
GO:0016311	0.660	dephosphorylation
GO:0042311	0.619	vasodilation
GO:0048523	0.610	negative regulation of cellular process
GO:0019538	0.589	protein metabolic process
GO:0040012	0.529	regulation of locomotion
GO:0048731	0.518	system development
GO:0051716	0.513	cellular response to stimulus
GO:0036211	0.511	protein modification process
GO:0007154	0.495	cell communication
GO:0023052	0.492	signaling
GO:0007165	0.467	signal transduction
GO:2000145	0.402	regulation of cell motility
GO:0030334	0.355	regulation of cell migration
GO:0048583	0.349	regulation of response to stimulus
GO:0006470	0.324	protein dephosphorylation
GO:0030154	0.311	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.986	organelle
GO:0005622	0.957	intracellular anatomical structure
GO:0030054	0.866	cell junction
GO:0043229	0.851	intracellular organelle
GO:0043227	0.830	membrane-bounded organelle
GO:0043231	0.765	intracellular membrane-bounded organelle
GO:0005737	0.473	cytoplasm
GO:0070161	0.356	anchoring junction
GO:0120025	0.351	plasma membrane bounded cell projection
GO:0043228	0.300	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]