StarFunc result for job id P28906

User Input

>input (385 residues)
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28906	1.000	1.000	1.341E-62	385	1.000	1.000	P28906.pdb.gz	CD34_HUMAN Hematopoietic progenitor cell antigen CD34 OS=Homo sapiens OX=9606 GN=CD34 PE=1 SV=2
2	AFDB:Q64314	0.460	0.463	2.674E-41	382	0.636	0.641	Q64314.pdb.gz	CD34_MOUSE Hematopoietic progenitor cell antigen CD34 OS=Mus musculus OX=10090 GN=Cd34 PE=1 SV=1
3	AFDB:B1PLB1	0.451	0.450	4.277E-40	386	0.639	0.637	B1PLB1.pdb.gz	B1PLB1_RAT CD34 molecule OS=Rattus norvegicus OX=10116 GN=Cd34 PE=1 SV=1
4	AFDB:A0A0C4DGW3	0.147	0.126	1.810E-6	475	0.190	0.154	A0A0C4DGW3.pdb.gz	A0A0C4DGW3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
5	AFDB:Q63475	0.183	0.078	1.023E-3	1004	0.127	0.049	Q63475.pdb.gz	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1
6	AFDB:Q8R1W8	0.167	0.094	1.636E-2	798	0.143	0.069	Q8R1W8.pdb.gz	IMPG1_MOUSE Interphotoreceptor matrix proteoglycan 1 OS=Mus musculus OX=10090 GN=Impg1 PE=1 SV=1
7	PDB:1tuvA	0.146	0.404	1.753E-2	103	0.029	0.107	1tuvA.pdb.gz	Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
8	AFDB:O00841	0.094	0.051	2.430E-2	802	0.148	0.071	O00841.pdb.gz	CUDA_DICDI Putative transcriptional regulator cudA OS=Dictyostelium discoideum OX=44689 GN=cudA PE=1 SV=2
9	AFDB:Q9FT70	0.071	0.031	2.430E-2	1150	0.161	0.054	Q9FT70.pdb.gz	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
10	AFDB:A0A087X0N3	0.087	0.051	2.773E-2	680	0.145	0.082	A0A087X0N3.pdb.gz	A0A087X0N3_HUMAN Nucleolar protein 4 like OS=Homo sapiens OX=9606 GN=NOL4L PE=1 SV=1
11	AFDB:Q9VA38	0.093	0.039	2.963E-2	1105	0.130	0.045	Q9VA38.pdb.gz	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
12	PDB:3cw2C	0.140	0.185	8.000E-2	266	0.039	0.056	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
13	PDB:2asyA	0.142	0.388	8.545E-2	101	0.042	0.158	2asyA.pdb.gz
14	PDB:3jcoW	0.087	0.143	1.548E-1	197	0.036	0.071	3jcoW.pdb.gz
15	PDB:7v61B	0.164	0.092	1.766E-1	751	0.057	0.029	7v61B.pdb.gz
16	PDB:1lxjA	0.116	0.291	1.887E-1	104	0.029	0.106	1lxjA.pdb.gz
17	PDB:2xmaE	0.118	0.223	2.300E-1	141	0.034	0.092	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
18	PDB:7kgbf	0.139	0.408	2.457E-1	95	0.021	0.084	7kgbf.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
19	PDB:1q53A	0.163	0.430	2.804E-1	112	0.021	0.071	1q53A.pdb.gz
20	PDB:6ofsA	0.115	0.063	3.418E-1	905	0.039	0.017	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28906	0.0	783	385	1.000	1.000	CD34_HUMAN Hematopoietic progenitor cell antigen CD34 OS=Homo sapiens OX=9606 GN=CD34 PE=1 SV=2
2	Q64314	1.82e-164	467	382	0.652	0.657	CD34_MOUSE Hematopoietic progenitor cell antigen CD34 OS=Mus musculus OX=10090 GN=Cd34 PE=1 SV=1
3	B1PLB1	1.07e-156	448	386	0.642	0.640	B1PLB1_RAT CD34 molecule OS=Rattus norvegicus OX=10116 GN=Cd34 PE=1 SV=1
4	O57604	1.49e-05	49.3	571	0.117	0.079	PODXL_CHICK Podocalyxin OS=Gallus gallus OX=9031 GN=PODXL PE=1 SV=1
5	P40457	0.049	38.5	1679	0.088	0.020	MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP2 PE=1 SV=1
6	Q383U8	0.20	35.8	246	0.109	0.171	Q383U8_TRYB2 NUDIX hydrolase, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1570 PE=3 SV=1
7	Q9R0M4	0.56	34.7	503	0.106	0.082	PODXL_MOUSE Podocalyxin OS=Mus musculus OX=10090 GN=Podxl PE=1 SV=2
8	D3Z941	1.1	33.9	902	0.062	0.027	D3Z941_RAT Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1
9	Q9WTQ2	2.3	32.7	485	0.236	0.188	PODXL_RAT Podocalyxin OS=Rattus norvegicus OX=10116 GN=Podxl PE=1 SV=2
10	Q8C5D8	4.4	32.0	621	0.057	0.035	PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2
11	A6MUT7	6.7	31.2	516	0.088	0.066	A6MUT7_TRICA Circadian locomoter output cycles protein kaput-like Protein OS=Tribolium castaneum OX=7070 GN=Met PE=1 SV=1
12	D0TZF0	8.2	31.2	803	0.036	0.017	ISOA1_ORYSJ Isoamylase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	2.9e-68	241.2	CD34/Podocalyxin family
2	PF13273 DUF4064	5.8e+02	12.2	Protein of unknown function (DUF4064)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236147	0.997	L-selectin
2	9606.ENSP00000457421	0.950	Platelet endothelial cell adhesion molecule
3	9606.ENSP00000346839	0.948	Fibronectin type III domain containing
4	9606.ENSP00000288135	0.927	Mast/stem cell growth factor receptor Kit
5	9606.ENSP00000284240	0.922	Thy-1 membrane glycoprotein
6	9606.ENSP00000362299	0.920	Endoglin
7	9606.ENSP00000411355	0.919	Receptor-type tyrosine-protein phosphatase C
8	9606.ENSP00000257770	0.910	5'-nucleotidase
9	9606.ENSP00000346300	0.894	Crk-like protein
10	9606.ENSP00000426809	0.894	Prominin-1
11	9606.ENSP00000379350	0.888	Integrin beta-1
12	9606.ENSP00000398632	0.888	CD44 antigen
13	9606.ENSP00000241453	0.879	Receptor-type tyrosine-protein kinase FLT3
14	9606.ENSP00000225474	0.878	Granulocyte colony-stimulating factor
15	9606.ENSP00000226279	0.878	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
16	9606.ENSP00000263923	0.878	Vascular endothelial growth factor receptor 2
17	9606.ENSP00000437940	0.878	B-lymphocyte antigen CD19
18	9606.ENSP00000228280	0.877	Kit ligand
19	9606.ENSP00000262262	0.870	Myeloid cell surface antigen CD33
20	9606.ENSP00000300060	0.869	Aminopeptidase N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030246	1.000	carbohydrate binding
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048856	0.980	anatomical structure development
GO:0048518	0.979	positive regulation of biological process
GO:0048519	0.978	negative regulation of biological process
GO:0048522	0.969	positive regulation of cellular process
GO:0032501	0.968	multicellular organismal process
GO:0051239	0.961	regulation of multicellular organismal process
GO:0019222	0.956	regulation of metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0051716	0.947	cellular response to stimulus
GO:0009893	0.941	positive regulation of metabolic process
GO:0007275	0.937	multicellular organism development
GO:0007165	0.937	signal transduction
GO:0048583	0.928	regulation of response to stimulus
GO:0031323	0.918	regulation of cellular metabolic process
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0010468	0.908	regulation of gene expression
GO:0051171	0.906	regulation of nitrogen compound metabolic process
GO:0048523	0.906	negative regulation of cellular process
GO:0048731	0.882	system development
GO:0007155	0.855	cell adhesion
GO:0030154	0.840	cell differentiation
GO:0031326	0.838	regulation of cellular biosynthetic process
GO:0006950	0.835	response to stress
GO:0065008	0.780	regulation of biological quality
GO:0051240	0.758	positive regulation of multicellular organismal process
GO:0048513	0.736	animal organ development
GO:0048870	0.729	cell motility
GO:0080134	0.716	regulation of response to stress
GO:0002376	0.714	immune system process
GO:0050793	0.699	regulation of developmental process
GO:0050878	0.689	regulation of body fluid levels
GO:0016477	0.682	cell migration
GO:0010628	0.678	positive regulation of gene expression
GO:0009892	0.668	negative regulation of metabolic process
GO:0010941	0.666	regulation of cell death
GO:0009888	0.649	tissue development
GO:0001822	0.630	kidney development
GO:0003094	0.615	glomerular filtration
GO:0010605	0.609	negative regulation of macromolecule metabolic process
GO:0048585	0.591	negative regulation of response to stimulus
GO:0032101	0.575	regulation of response to external stimulus
GO:0072006	0.555	nephron development
GO:1900046	0.488	regulation of hemostasis
GO:0050818	0.454	regulation of coagulation
GO:0080090	0.445	regulation of primary metabolic process
GO:0009653	0.435	anatomical structure morphogenesis
GO:0071840	0.427	cellular component organization or biogenesis
GO:0032835	0.426	glomerulus development
GO:0061005	0.421	cell differentiation involved in kidney development
GO:0001817	0.406	regulation of cytokine production
GO:0042221	0.402	response to chemical
GO:0016043	0.392	cellular component organization
GO:0051241	0.385	negative regulation of multicellular organismal process
GO:0060429	0.378	epithelium development
GO:0051094	0.377	positive regulation of developmental process
GO:0032102	0.364	negative regulation of response to external stimulus
GO:0045595	0.362	regulation of cell differentiation
GO:0042127	0.338	regulation of cell population proliferation
GO:2000026	0.335	regulation of multicellular organismal development
GO:0061041	0.334	regulation of wound healing
GO:0007166	0.333	cell surface receptor signaling pathway
GO:0048468	0.308	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0009986	0.962	cell surface
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005576	0.905	extracellular region
GO:0098552	0.858	side of membrane
GO:0009897	0.770	external side of plasma membrane
GO:0005615	0.691	extracellular space
GO:0070013	0.525	intracellular organelle lumen
GO:0005829	0.479	cytosol
GO:0031982	0.423	vesicle
GO:0070062	0.408	extracellular exosome
GO:0031981	0.400	nuclear lumen
GO:0012505	0.394	endomembrane system
GO:0048471	0.373	perinuclear region of cytoplasm
GO:0032991	0.354	protein-containing complex
GO:0031090	0.307	organelle membrane
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]