StarFunc result for job id P28907

User Input

>input (300 residues)
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28907	1.000	1.000	8.288E-60	300	1.000	1.000	P28907.pdb.gz	CD38_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens OX=9606 GN=CD38 PE=1 SV=2
2	AFDB:Q64244	0.769	0.762	1.418E-37	303	0.580	0.574	Q64244.pdb.gz	CD38_RAT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Cd38 PE=1 SV=1
3	AFDB:P56528	0.768	0.758	3.697E-37	304	0.587	0.579	P56528.pdb.gz	CD38_MOUSE ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Mus musculus OX=10090 GN=Cd38 PE=1 SV=2
4	AFDB:Q9MZ03	0.762	0.766	3.424E-33	298	0.533	0.537	Q9MZ03.pdb.gz	CD38_RABIT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Oryctolagus cuniculus OX=9986 GN=CD38 PE=1 SV=1
5	AFDB:Q10588	0.778	0.738	3.859E-26	318	0.327	0.308	Q10588.pdb.gz	BST1_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 OS=Homo sapiens OX=9606 GN=BST1 PE=1 SV=2
6	PDB:1isgA	0.728	0.864	9.246E-24	250	0.310	0.372	1isgA.pdb.gz	Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
7	AFDB:D9YZV0	0.260	0.133	4.749E-3	684	0.083	0.037	D9YZV0.pdb.gz	D9YZV0_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
8	AFDB:F4KI84	0.276	0.143	1.239E-2	668	0.070	0.031	F4KI84.pdb.gz	F4KI84_ARATH Translation elongation factor EF1A/initiation factor IF2gamma family protein OS=Arabidopsis thaliana OX=3702 GN=HBS1 PE=1 SV=1
9	PDB:2oo0A	0.210	0.166	1.658E-2	419	0.093	0.067	2oo0A.pdb.gz	A structural insight into the inhibition of human and Leishmania donovani ornithine decarboxylases by 1-amino-oxy-3-aminopropane.
10	PDB:6cesA	0.310	0.310	2.078E-2	300	0.070	0.070	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
11	PDB:1tikA	0.254	0.336	2.198E-2	203	0.100	0.148	1tikA.pdb.gz
12	PDB:4arzA	0.319	0.327	2.326E-2	291	0.073	0.076	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
13	AFDB:F1RDR4	0.267	0.277	2.578E-2	287	0.070	0.073	F1RDR4.pdb.gz	F1RDR4_DANRE ADP-ribosylation factor-like 15b OS=Danio rerio OX=7955 GN=arl15b PE=1 SV=2
14	AFDB:Q69ZS7	0.205	0.108	2.578E-2	682	0.083	0.037	Q69ZS7.pdb.gz	HBS1L_MOUSE HBS1-like protein OS=Mus musculus OX=10090 GN=Hbs1l PE=1 SV=2
15	PDB:5lztjj	0.227	0.171	3.652E-2	428	0.067	0.047	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
16	AFDB:Q9SW44	0.154	0.088	5.070E-2	626	0.117	0.056	Q9SW44.pdb.gz	RH16_ARATH DEAD-box ATP-dependent RNA helicase 16 OS=Arabidopsis thaliana OX=3702 GN=RH16 PE=2 SV=1
17	PDB:2mt9A	0.257	0.406	5.733E-2	173	0.060	0.104	2mt9A.pdb.gz	Long-chain flavodoxin FldB from Escherichia coli
18	PDB:5szjA	0.246	0.367	5.733E-2	175	0.083	0.143	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
19	PDB:6fyxk	0.180	0.140	5.733E-2	414	0.047	0.034	6fyxk.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:3o3mD	0.223	0.187	6.789E-2	375	0.087	0.069	3o3mD.pdb.gz	Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28907	0.0	625	300	1.000	1.000	CD38_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens OX=9606 GN=CD38 PE=1 SV=2
2	P56528	4.17e-123	356	304	0.590	0.582	CD38_MOUSE ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Mus musculus OX=10090 GN=Cd38 PE=1 SV=2
3	Q64244	8.42e-117	340	303	0.587	0.581	CD38_RAT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Cd38 PE=1 SV=1
4	Q9MZ03	1.15e-110	324	298	0.537	0.540	CD38_RABIT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Oryctolagus cuniculus OX=9986 GN=CD38 PE=1 SV=1
5	Q10588	5.58e-54	180	318	0.310	0.292	BST1_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 OS=Homo sapiens OX=9606 GN=BST1 PE=1 SV=2
6	Q0WUC5	0.90	33.5	566	0.100	0.053	ALB33_ARATH ALBINO3-like protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALB3L3 PE=1 SV=1
7	Q2HIR7	5.7	30.8	286	0.070	0.073	Q2HIR7_ARATH Acclimation of photosynthesis to environment OS=Arabidopsis thaliana OX=3702 GN=APE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03954 Lectin_N	2.6e+02	12.8	Hepatic lectin, N-terminal domain
2	PF02267 Rib_hydrolayse	6e-95	328.7	ADP-ribosyl cyclase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226279

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457421	0.991	Platelet endothelial cell adhesion molecule
2	9606.ENSP00000264033	0.970	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000222553	0.950	Nicotinamide phosphoribosyltransferase
4	9606.ENSP00000366410	0.942	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
5	9606.ENSP00000287713	0.933	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
6	9606.ENSP00000340523	0.933	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
7	9606.ENSP00000354238	0.924	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
8	9606.ENSP00000441434	0.922	Nicotinamide N-methyltransferase
9	9606.ENSP00000406261	0.920	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
10	9606.ENSP00000356946	0.918	Low affinity immunoglobulin gamma Fc region receptor III-A
11	9606.ENSP00000354532	0.917	Purine nucleoside phosphorylase
12	9606.ENSP00000265016	0.913	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
13	9606.ENSP00000437940	0.908	B-lymphocyte antigen CD19
14	9606.ENSP00000264663	0.902	NAD(P) transhydrogenase, mitochondrial
15	9606.ENSP00000326424	0.902	Glutamine-dependent NAD(+) synthetase
16	9606.ENSP00000230792	0.900	Peroxisomal NADH pyrophosphatase NUDT12
17	9606.ENSP00000371362	0.900	NAD kinase 2, mitochondrial
18	9606.ENSP00000011653	0.899	T-cell surface glycoprotein CD4
19	9606.ENSP00000266557	0.881	CD27 antigen
20	9606.ENSP00000310036	0.878	Hematopoietic progenitor cell antigen CD34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003953	1.000	NAD+ nucleosidase activity
GO:0005515	0.933	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0050896	0.991	response to stimulus
GO:0007154	0.991	cell communication
GO:0023052	0.990	signaling
GO:0008284	0.989	positive regulation of cell population proliferation
GO:0051716	0.955	cellular response to stimulus
GO:0007165	0.949	signal transduction
GO:0002376	0.944	immune system process
GO:0051240	0.942	positive regulation of multicellular organismal process
GO:0002682	0.920	regulation of immune system process
GO:0002684	0.911	positive regulation of immune system process
GO:0050864	0.897	regulation of B cell activation
GO:0019222	0.862	regulation of metabolic process
GO:0050670	0.791	regulation of lymphocyte proliferation
GO:0060255	0.736	regulation of macromolecule metabolic process
GO:0048583	0.703	regulation of response to stimulus
GO:0030888	0.690	regulation of B cell proliferation
GO:0048523	0.687	negative regulation of cellular process
GO:0031323	0.678	regulation of cellular metabolic process
GO:0071704	0.669	organic substance metabolic process
GO:0051171	0.664	regulation of nitrogen compound metabolic process
GO:0048584	0.663	positive regulation of response to stimulus
GO:0080090	0.660	regulation of primary metabolic process
GO:0007166	0.645	cell surface receptor signaling pathway
GO:0042221	0.621	response to chemical
GO:0009893	0.598	positive regulation of metabolic process
GO:0044238	0.595	primary metabolic process
GO:0002696	0.593	positive regulation of leukocyte activation
GO:0010468	0.580	regulation of gene expression
GO:0006807	0.570	nitrogen compound metabolic process
GO:0044237	0.542	cellular metabolic process
GO:0032501	0.531	multicellular organismal process
GO:0051251	0.525	positive regulation of lymphocyte activation
GO:0031325	0.504	positive regulation of cellular metabolic process
GO:0050776	0.502	regulation of immune response
GO:0010604	0.489	positive regulation of macromolecule metabolic process
GO:1901564	0.476	organonitrogen compound metabolic process
GO:0010941	0.457	regulation of cell death
GO:0031326	0.438	regulation of cellular biosynthetic process
GO:0019219	0.434	regulation of nucleobase-containing compound metabolic process
GO:0070665	0.422	positive regulation of leukocyte proliferation
GO:0010556	0.421	regulation of macromolecule biosynthetic process
GO:0051252	0.419	regulation of RNA metabolic process
GO:2001141	0.402	regulation of RNA biosynthetic process
GO:0050671	0.395	positive regulation of lymphocyte proliferation
GO:0051173	0.392	positive regulation of nitrogen compound metabolic process
GO:0043067	0.383	regulation of programmed cell death
GO:0050778	0.367	positive regulation of immune response
GO:0006796	0.347	phosphate-containing compound metabolic process
GO:0009892	0.331	negative regulation of metabolic process
GO:1903506	0.309	regulation of nucleic acid-templated transcription
GO:0002768	0.308	immune response-regulating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0031982	0.991	vesicle
GO:0005576	0.989	extracellular region
GO:0005622	0.945	intracellular anatomical structure
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0005615	0.906	extracellular space
GO:0070062	0.888	extracellular exosome
GO:0005737	0.673	cytoplasm
GO:0009986	0.662	cell surface
GO:0012505	0.396	endomembrane system
GO:0098588	0.315	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16301	1.000	H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide

[back to server]