StarFunc result for job id P28908

User Input

>input (595 residues)
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28908	0.999	0.999	2.955E-93	595	1.000	1.000	P28908.pdb.gz	TNR8_HUMAN Tumor necrosis factor receptor superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFRSF8 PE=1 SV=1
2	AFDB:Q9HCU0	0.066	0.057	7.107E-3	757	0.134	0.106	Q9HCU0.pdb.gz	CD248_HUMAN Endosialin OS=Homo sapiens OX=9606 GN=CD248 PE=1 SV=1
3	AFDB:Q9V8P9	0.069	0.045	1.115E-1	1038	0.153	0.088	Q9V8P9.pdb.gz	TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster OX=7227 GN=Topors PE=1 SV=1
4	AFDB:Q5A201	0.052	0.048	2.906E-1	712	0.121	0.101	Q5A201.pdb.gz	GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GZF3 PE=2 SV=2
5	AFDB:Q9ER99	0.056	0.057	6.327E-1	582	0.134	0.137	Q9ER99.pdb.gz	RSCA1_MOUSE Regulatory solute carrier protein family 1 member 1 OS=Mus musculus OX=10090 GN=Rsc1a1 PE=1 SV=2
6	PDB:7q3nU	0.081	0.131	9.575E-1	292	0.030	0.062	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
7	AFDB:A0A0B4KEU9	0.048	0.037	1.463	804	0.143	0.106	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	AFDB:B1AR10	0.075	0.043	1.463	1109	0.180	0.096	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
9	AFDB:Q7JN04	0.045	0.027	1.750	1085	0.126	0.069	Q7JN04.pdb.gz	Q7JN04_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=1
10	PDB:8a7dQ	0.061	0.093	1.964	273	0.032	0.070	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
11	AFDB:A0A087X1S9	0.060	0.039	2.095	1069	0.153	0.085	A0A087X1S9.pdb.gz	A0A087X1S9_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
12	AFDB:Q9JIK1	0.076	0.057	2.095	862	0.153	0.106	Q9JIK1.pdb.gz	CDHR5_RAT Cadherin-related family member 5 OS=Rattus norvegicus OX=10116 GN=Cdhr5 PE=1 SV=1
13	PDB:1c1zA	0.066	0.098	3.365	326	0.050	0.092	1c1zA.pdb.gz
14	PDB:7bwaA	0.049	0.045	4.276	674	0.027	0.024	7bwaA.pdb.gz
15	PDB:2q7zA	0.073	0.034	4.539	1931	0.029	0.009	2q7zA.pdb.gz
16	PDB:6qdvc	0.040	0.080	4.539	269	0.015	0.033	6qdvc.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
17	PDB:4a5wB	0.056	0.044	6.501	871	0.020	0.014	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
18	PDB:5okzQ	0.057	0.119	7.779	207	0.034	0.097	5okzQ.pdb.gz	Mpp6 Incorporation in the Nuclear Exosome Contributes to RNA Channeling through the Mtr4 Helicase.
19	PDB:6pyhD	0.048	0.038	8.768	798	0.025	0.019	6pyhD.pdb.gz
20	PDB:8eyyA	0.030	0.023	9.309	775	0.012	0.009	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P28908	0.0	1203	595	1.000	1.000	TNR8_HUMAN Tumor necrosis factor receptor superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFRSF8 PE=1 SV=1
2	P97525	7.29e-89	285	492	0.271	0.327	TNR8_RAT Tumor necrosis factor receptor superfamily member 8 OS=Rattus norvegicus OX=10116 GN=Tnfrsf8 PE=2 SV=2
3	P20333	1.11e-11	69.7	461	0.113	0.145	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
4	P36941	4.19e-10	64.3	435	0.087	0.120	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
5	P25119	1.42e-08	59.7	474	0.061	0.076	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
6	F5H6F8	9.84e-08	55.1	217	0.082	0.226	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
7	F1RAS9	4.82e-07	54.7	425	0.072	0.101	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
8	Q80WM9	1.80e-06	52.0	275	0.062	0.135	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
9	Q71F55	1.88e-06	52.0	276	0.062	0.134	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
10	O95407	2.79e-06	52.0	300	0.066	0.130	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
11	O75509	1.42e-05	50.4	655	0.057	0.052	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
12	O19131	2.66e-05	49.3	471	0.062	0.079	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
13	O00300	6.92e-05	47.8	401	0.057	0.085	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
14	W5U6M1	7.23e-05	47.4	311	0.062	0.119	W5U6M1_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=FAS PE=2 SV=1
15	D3ZF92	1.16e-04	47.4	655	0.052	0.047	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
16	Q80WY6	1.19e-04	47.4	474	0.055	0.070	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
17	Q9EPU5	1.58e-04	47.0	655	0.052	0.047	TNR21_MOUSE Tumor necrosis factor receptor superfamily member 21 OS=Mus musculus OX=10090 GN=Tnfrsf21 PE=1 SV=2
18	Q6E5U7	2.00e-04	46.2	312	0.061	0.115	Q6E5U7_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=fas PE=2 SV=1
19	P50284	2.72e-04	46.2	415	0.055	0.080	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
20	A5D8S6	2.93e-04	46.2	637	0.071	0.066	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00020 TNFR_c6	3.8e-05	35.4	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223795	0.998	Tumor necrosis factor ligand superfamily member 8
2	9606.ENSP00000454207	0.977	TNF receptor-associated factor 3
3	9606.ENSP00000362994	0.962	TNF receptor-associated factor 1
4	9606.ENSP00000247668	0.958	TNF receptor-associated factor 2
5	9606.ENSP00000261464	0.926	TNF receptor-associated factor 5
6	9606.ENSP00000373700	0.872	ALK tyrosine kinase receptor
7	9606.ENSP00000351602	0.861	Alpha-(1,3)-fucosyltransferase 4
8	9606.ENSP00000221972	0.816	B-cell antigen receptor complex-associated protein alpha chain
9	9606.ENSP00000342681	0.815	T-cell surface glycoprotein CD5
10	9606.ENSP00000384371	0.801	B-cell lymphoma 6 protein
11	9606.ENSP00000350844	0.775	Paired box protein Pax-5
12	9606.ENSP00000302530	0.773	Mitotic checkpoint serine/threonine-protein kinase BUB1
13	9606.ENSP00000418525	0.769	Neprilysin
14	9606.ENSP00000011653	0.767	T-cell surface glycoprotein CD4
15	9606.ENSP00000312027	0.766	T-cell antigen CD7
16	9606.ENSP00000358490	0.763	T-cell surface antigen CD2
17	9606.ENSP00000368538	0.754	Tumor necrosis factor receptor superfamily member 4
18	9606.ENSP00000411355	0.748	Receptor-type tyrosine-protein phosphatase C
19	9606.ENSP00000386559	0.744	T-cell surface glycoprotein CD8 alpha chain
20	9606.ENSP00000401371	0.740	Nucleolysin TIA-1 isoform p40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0005515	0.962	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	1.000	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0048518	0.992	positive regulation of biological process
GO:0010941	0.990	regulation of cell death
GO:0019222	0.989	regulation of metabolic process
GO:0043067	0.984	regulation of programmed cell death
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0051716	0.981	cellular response to stimulus
GO:0048522	0.980	positive regulation of cellular process
GO:0007154	0.971	cell communication
GO:0051240	0.963	positive regulation of multicellular organismal process
GO:0010468	0.961	regulation of gene expression
GO:0048523	0.955	negative regulation of cellular process
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0009605	0.949	response to external stimulus
GO:0007165	0.936	signal transduction
GO:0001817	0.935	regulation of cytokine production
GO:0042127	0.920	regulation of cell population proliferation
GO:0042981	0.879	regulation of apoptotic process
GO:0010628	0.816	positive regulation of gene expression
GO:0001819	0.619	positive regulation of cytokine production
GO:0071496	0.553	cellular response to external stimulus
GO:0071214	0.552	cellular response to abiotic stimulus
GO:0009612	0.551	response to mechanical stimulus
GO:0071260	0.526	cellular response to mechanical stimulus
GO:0043065	0.497	positive regulation of apoptotic process
GO:0080090	0.456	regulation of primary metabolic process
GO:0051171	0.451	regulation of nitrogen compound metabolic process
GO:0008285	0.444	negative regulation of cell population proliferation
GO:0031323	0.421	regulation of cellular metabolic process
GO:0048583	0.372	regulation of response to stimulus
GO:0009889	0.317	regulation of biosynthetic process
GO:0010556	0.311	regulation of macromolecule biosynthetic process
GO:0031326	0.311	regulation of cellular biosynthetic process
GO:0051252	0.310	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0070062	0.995	extracellular exosome
GO:0005622	0.940	intracellular anatomical structure
GO:0043229	0.875	intracellular organelle
GO:0005737	0.869	cytoplasm
GO:0043231	0.865	intracellular membrane-bounded organelle
GO:0012505	0.637	endomembrane system
GO:0070013	0.376	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]