StarFunc result for job id P29016

User Input

>input (333 residues)
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29016	1.000	1.000	7.075E-66	333	1.000	1.000	P29016.pdb.gz	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
2	AFDB:P06126	0.811	0.824	2.122E-44	327	0.595	0.606	P06126.pdb.gz	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
3	AFDB:P29017	0.804	0.804	2.122E-44	333	0.604	0.604	P29017.pdb.gz	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
4	AFDB:P15812	0.806	0.694	1.043E-43	388	0.535	0.459	P15812.pdb.gz	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
5	AFDB:P15813	0.818	0.814	5.745E-41	335	0.514	0.510	P15813.pdb.gz	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	AFDB:P11609	0.810	0.803	2.845E-37	336	0.462	0.458	P11609.pdb.gz	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
7	PDB:3ov6A	0.774	0.688	5.445E-37	376	0.580	0.513	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
8	PDB:3s6cA	0.767	0.689	9.427E-37	372	0.502	0.449	3s6cA.pdb.gz
9	PDB:1cd1A	0.777	0.942	4.454E-30	273	0.405	0.495	1cd1A.pdb.gz
10	AFDB:U3PTD3	0.696	0.676	6.708E-24	344	0.207	0.201	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
11	AFDB:A0ZXM3	0.675	0.635	1.801E-23	357	0.225	0.210	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
12	AFDB:Q95460	0.743	0.728	2.511E-22	341	0.222	0.217	Q95460.pdb.gz	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
13	AFDB:Q30201	0.706	0.678	3.490E-22	348	0.189	0.181	Q30201.pdb.gz	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
14	PDB:5j6hA	0.662	0.784	1.042E-19	275	0.195	0.236	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6fgbA	0.689	0.851	1.804E-19	265	0.186	0.234	6fgbA.pdb.gz
16	PDB:6e1iA	0.645	0.563	7.939E-19	389	0.192	0.165	6e1iA.pdb.gz
17	PDB:3es6A	0.662	0.778	2.514E-18	277	0.204	0.245	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6mp0A	0.652	0.569	2.656E-18	388	0.180	0.155	6mp0A.pdb.gz
19	PDB:2qriA	0.683	0.581	4.352E-18	398	0.183	0.153	2qriA.pdb.gz
20	PDB:6d7gA	0.641	0.563	2.138E-17	386	0.183	0.158	6d7gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29016	0.0	684	333	1.000	1.000	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
2	H7C0I2	1.33e-158	445	246	0.721	0.976	H7C0I2_HUMAN CD1b molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
3	P29017	1.99e-134	387	333	0.580	0.580	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
4	P06126	2.88e-129	374	327	0.568	0.578	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
5	P15812	1.08e-118	349	388	0.505	0.433	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
6	P15813	2.21e-112	331	335	0.508	0.504	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
7	H0Y6Y6	3.55e-98	293	281	0.432	0.512	H0Y6Y6_HUMAN CD1c molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=1
8	P11609	1.75e-97	293	336	0.474	0.470	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
9	P11610	1.30e-91	278	336	0.462	0.458	CD1D2_MOUSE Antigen-presenting glycoprotein CD1d2 OS=Mus musculus OX=10090 GN=Cd1d2 PE=1 SV=2
10	A0A669KB34	2.14e-41	146	242	0.219	0.302	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
11	U3PTD3	9.98e-19	87.8	344	0.162	0.157	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q95601	3.77e-18	86.3	355	0.204	0.192	Q95601_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=BFIV21 PE=1 SV=1
13	A0ZXM3	5.50e-17	82.8	357	0.171	0.160	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
14	Q95460	1.03e-16	82.0	341	0.222	0.217	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
15	O46789	2.08e-16	81.3	355	0.159	0.149	O46789_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
16	F1CN43	2.58e-16	80.9	344	0.159	0.154	F1CN43_CHICK MHC class I antigen OS=Gallus gallus OX=9031 PE=2 SV=1
17	O46790	8.86e-16	79.3	355	0.156	0.146	O46790_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
18	P25311	2.85e-14	74.3	298	0.198	0.221	ZA2G_HUMAN Zinc-alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=AZGP1 PE=1 SV=2
19	Q6MGB8	3.27e-14	74.7	366	0.219	0.199	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
20	Q63678	2.03e-13	72.0	296	0.189	0.213	ZA2G_RAT Zinc-alpha-2-glycoprotein OS=Rattus norvegicus OX=10116 GN=Azgp1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.9e-08	45.3	Immunoglobulin C1-set domain
2	PF11857 DUF3377	3.8e+02	12.4	Domain of unknown function (DUF3377)
3	PF13927 Ig_3	2.7e+02	13.5	Immunoglobulin domain
4	PF00129 MHC_I	2.1	19.4	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF16497 MHC_I_3	6.5e-68	239.7	MHC-I family domain
6	PF14991 MLANA	6.4e+02	12.0	Protein melan-A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452780	0.998	Beta-2-microglobulin
2	9606.ENSP00000368450	0.872	CD83 antigen
3	9606.ENSP00000250092	0.860	Macrosialin
4	9606.ENSP00000386378	0.860	C-type lectin domain family 4 member K
5	9606.ENSP00000011653	0.825	T-cell surface glycoprotein CD4
6	9606.ENSP00000332049	0.820	T-lymphocyte activation antigen CD86
7	9606.ENSP00000289429	0.815	T-cell surface glycoprotein CD1a
8	9606.ENSP00000357149	0.785	T-cell surface glycoprotein CD1e, membrane-associated
9	9606.ENSP00000264246	0.775	T-lymphocyte activation antigen CD80
10	9606.ENSP00000300692	0.747	T-cell surface glycoprotein CD3 delta chain
11	9606.ENSP00000354566	0.745	T-cell surface glycoprotein CD3 epsilon chain
12	9606.ENSP00000296871	0.744	Granulocyte-macrophage colony-stimulating factor
13	9606.ENSP00000342681	0.739	T-cell surface glycoprotein CD5
14	9606.ENSP00000386559	0.739	T-cell surface glycoprotein CD8 alpha chain
15	9606.ENSP00000310036	0.734	Hematopoietic progenitor cell antigen CD34
16	9606.ENSP00000315477	0.733	CD209 antigen
17	9606.ENSP00000357152	0.731	T-cell surface glycoprotein CD1c
18	9606.ENSP00000231449	0.721	Interleukin-4
19	9606.ENSP00000361359	0.720	Tumor necrosis factor receptor superfamily member 5
20	9606.ENSP00000454623	0.715	Integrin alpha-X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.944	antigen binding
GO:0005102	0.672	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050896	0.986	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0002376	0.948	immune system process
GO:0032501	0.946	multicellular organismal process
GO:0048518	0.940	positive regulation of biological process
GO:0002682	0.889	regulation of immune system process
GO:0045321	0.877	leukocyte activation
GO:0048522	0.868	positive regulation of cellular process
GO:0048583	0.757	regulation of response to stimulus
GO:0002684	0.722	positive regulation of immune system process
GO:0050776	0.671	regulation of immune response
GO:0048584	0.616	positive regulation of response to stimulus
GO:0019222	0.507	regulation of metabolic process
GO:0046649	0.498	lymphocyte activation
GO:0051239	0.477	regulation of multicellular organismal process
GO:0006955	0.465	immune response
GO:0060255	0.457	regulation of macromolecule metabolic process
GO:0009605	0.452	response to external stimulus
GO:0051240	0.437	positive regulation of multicellular organismal process
GO:0050865	0.431	regulation of cell activation
GO:0002694	0.423	regulation of leukocyte activation
GO:0050778	0.408	positive regulation of immune response
GO:0048519	0.407	negative regulation of biological process
GO:0032502	0.385	developmental process
GO:0051716	0.382	cellular response to stimulus
GO:0048856	0.380	anatomical structure development
GO:0010468	0.352	regulation of gene expression
GO:0006950	0.342	response to stress
GO:0009893	0.334	positive regulation of metabolic process
GO:0051249	0.324	regulation of lymphocyte activation
GO:0010604	0.321	positive regulation of macromolecule metabolic process
GO:0009607	0.318	response to biotic stimulus
GO:0042127	0.311	regulation of cell population proliferation
GO:0051251	0.309	positive regulation of lymphocyte activation
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005794	0.989	Golgi apparatus
GO:0005576	0.893	extracellular region
GO:0009986	0.777	cell surface
GO:0005829	0.665	cytosol
GO:0031982	0.602	vesicle
GO:0031090	0.314	organelle membrane
GO:0098588	0.302	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]