StarFunc result for job id P29122

User Input

>input (969 residues)
MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAA
CSAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTL
SSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRC
RSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDA
SNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYID
IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGY
TNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGL
VDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLE
HVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEG
QWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPELEPP
KAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECGDKGCDGPNADQCLNCVHFSL
GSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRGFYHHQEMNTC
VTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRR
CDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQF
CCRTCLLAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2BHH6	0.490	0.261	0.000	1821	0.482	0.256	A2BHH6.pdb.gz
2	AFDB:H3BJL4	0.291	0.354	0.000	798	0.763	0.926	H3BJL4.pdb.gz	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
3	AFDB:P29122	1.000	1.000	0.000	969	1.000	1.000	P29122.pdb.gz	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
4	AFDB:P41413	0.499	0.269	0.000	1809	0.519	0.278	P41413.pdb.gz	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
5	AFDB:Q04592	0.500	0.260	0.000	1877	0.522	0.270	Q04592.pdb.gz	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
6	AFDB:Q92824	0.512	0.270	0.000	1860	0.517	0.269	Q92824.pdb.gz	PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=4
7	AFDB:P30432	0.490	0.285	1.353E-102	1679	0.415	0.239	P30432.pdb.gz	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
8	AFDB:F1QQ43	0.476	0.571	4.202E-90	806	0.368	0.443	F1QQ43.pdb.gz	F1QQ43_DANRE Furin (paired basic amino acid cleaving enzyme) a OS=Danio rerio OX=7955 GN=furin PE=3 SV=3
9	AFDB:P09958	0.471	0.574	1.107E-88	794	0.362	0.442	P09958.pdb.gz	FURIN_HUMAN Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2
10	AFDB:F1QKU2	0.473	0.556	1.568E-87	823	0.357	0.420	F1QKU2.pdb.gz	F1QKU2_DANRE Furin (paired basic amino acid cleaving enzyme) b OS=Danio rerio OX=7955 GN=furinb PE=3 SV=1
11	PDB:1r6vA	0.269	0.378	1.900E-17	671	0.105	0.152	1r6vA.pdb.gz	Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
12	PDB:2x8jD	0.249	0.740	3.072E-14	308	0.068	0.214	2x8jD.pdb.gz
13	PDB:3wivC	0.256	0.596	9.492E-14	397	0.077	0.189	3wivC.pdb.gz	Requirement of the insertion sequence for activation of Tk-subtilisin
14	PDB:6u3xB	0.231	0.433	1.084E-11	486	0.080	0.160	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
15	PDB:3lxuX	0.186	0.151	3.649E-8	1217	0.074	0.059	3lxuX.pdb.gz
16	PDB:3edyA	0.193	0.320	5.901E-5	544	0.064	0.114	3edyA.pdb.gz	Crystal Structure and Autoactivation Pathway of the Precursor Form of Human Tripeptidyl-peptidase 1, the Enzyme Deficient in Late Infantile Ceroid Lipofuscinosis
17	PDB:7mn8B	0.069	0.111	3.587E-4	579	0.056	0.093	7mn8B.pdb.gz
18	PDB:2waaA	0.067	0.150	7.467E-4	335	0.024	0.069	2waaA.pdb.gz
19	PDB:4kncB	0.083	0.169	8.844E-4	419	0.025	0.057	4kncB.pdb.gz
20	PDB:7ufgA	0.107	0.097	9.357E-4	1151	0.068	0.057	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A669KA35	1014	1887	0.512	0.263	A0A669KA35_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens OX=9606 GN=PCSK5 PE=1 SV=1
2	E9Q4D0	1745	946	0.882	0.904	E9Q4D0_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=2
3	F1QKU2	647	823	0.362	0.426	F1QKU2_DANRE Furin (paired basic amino acid cleaving enzyme) b OS=Danio rerio OX=7955 GN=furinb PE=3 SV=1
4	F1QQ43	660	806	0.370	0.445	F1QQ43_DANRE Furin (paired basic amino acid cleaving enzyme) a OS=Danio rerio OX=7955 GN=furin PE=3 SV=3
5	F6XJP7	1769	959	0.892	0.901	F6XJP7_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
6	H3BJL4	688	798	0.343	0.416	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
7	O17798	642	692	0.337	0.473	FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans OX=6239 GN=kpc-1 PE=1 SV=3
8	O35171	564	296	0.273	0.895	O35171_MOUSE PACE4 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=2 SV=1
9	P09958	659	794	0.374	0.456	FURIN_HUMAN Furin OS=Homo sapiens OX=9606 GN=FURIN PE=1 SV=2
10	P23188	655	793	0.367	0.449	FURIN_MOUSE Furin OS=Mus musculus OX=10090 GN=Furin PE=1 SV=2
11	P23377	653	793	0.366	0.448	FURIN_RAT Furin OS=Rattus norvegicus OX=10116 GN=Furin PE=1 SV=1
12	P26016	587	1269	0.315	0.240	FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2
13	P28840	600	752	0.324	0.418	NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus OX=10116 GN=Pcsk1 PE=2 SV=1
14	P29120	599	753	0.310	0.398	NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens OX=9606 GN=PCSK1 PE=1 SV=2
15	P29121	585	655	0.289	0.427	PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus OX=10090 GN=Pcsk4 PE=2 SV=1
16	P29122	2020	969	1.000	1.000	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
17	P30430	580	1101	0.311	0.273	FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster OX=7227 GN=Fur1 PE=2 SV=2
18	P30432	694	1679	0.411	0.237	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
19	P41413	1021	1809	0.526	0.282	PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus OX=10116 GN=Pcsk5 PE=2 SV=3
20	P51559	552	942	0.357	0.367	BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans OX=6239 GN=bli-4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15913 Furin-like_2	1e-07	43.5	Furin-like repeat, cysteine-rich
2	PF14843 GF_recep_IV	5.9e-10	50.5	Growth factor receptor domain IV
3	PF00082 Peptidase_S8	1.4e-43	160.8	Subtilase family
4	PF08686 PLAC	0.0005	32.1	PLAC (protease and lacunin) domain
5	PF01483 P_proprotein	1.6e-29	113.1	Proprotein convertase P-domain
6	PF16470 S8_pro-domain	8.4e-23	92.0	Peptidase S8 pro-domain
7	PF03302 VSP	0.18	22.2	Giardia variant-specific surface protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482760

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287139	0.940	Nodal homolog
2	9606.ENSP00000357789	0.921	Filaggrin
3	9606.ENSP00000358525	0.916	Beta-nerve growth factor
4	9606.ENSP00000480053	0.908	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
5	9606.ENSP00000309757	0.906	Lipoprotein lipase
6	9606.ENSP00000252252	0.801	Keratin, type II cytoskeletal 6B
7	9606.ENSP00000295057	0.753	Leucine-rich repeat transmembrane neuronal protein 1
8	9606.ENSP00000344223	0.716	Membrane-bound transcription factor site-1 protease
9	9606.ENSP00000303208	0.703	Proprotein convertase subtilisin/kexin type 9
10	9606.ENSP00000422488	0.699	Steroid hormone receptor ERR2
11	9606.ENSP00000363516	0.672	Calcipressin-3
12	9606.ENSP00000300175	0.664	Neuroendocrine protein 7B2
13	9606.ENSP00000357986	0.652	Pleckstrin homology domain-containing family A member 1
14	9606.ENSP00000233078	0.650	DAZ-associated protein 1
15	9606.ENSP00000398632	0.637	CD44 antigen
16	9606.ENSP00000324173	0.621	78 kDa glucose-regulated protein
17	9606.ENSP00000303042	0.595	Actin filament-associated protein 1-like 2
18	9606.ENSP00000273857	0.579	Atrial natriuretic peptide-converting enzyme
19	9606.ENSP00000332139	0.575	Complement factor D
20	9606.ENSP00000424126	0.574	Multiple C2 and transmembrane domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	0.996	serine-type endopeptidase activity
GO:0005515	0.995	protein binding
GO:0008201	0.897	heparin binding
GO:0019838	0.797	growth factor binding
GO:0048406	0.427	nerve growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0051604	0.982	protein maturation
GO:0032502	0.965	developmental process
GO:0048856	0.964	anatomical structure development
GO:0006508	0.959	proteolysis
GO:0016485	0.950	protein processing
GO:0007275	0.949	multicellular organism development
GO:0065007	0.798	biological regulation
GO:0008595	0.748	anterior/posterior axis specification, embryo
GO:0009987	0.603	cellular process
GO:0050789	0.556	regulation of biological process
GO:0050794	0.445	regulation of cellular process
GO:0060972	0.422	left/right pattern formation
GO:0009799	0.365	specification of symmetry

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.998	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005737	0.993	cytoplasm
GO:0016020	0.976	membrane
GO:0071944	0.972	cell periphery
GO:0005615	0.943	extracellular space
GO:0005886	0.918	plasma membrane
GO:0005794	0.772	Golgi apparatus
GO:0031012	0.378	extracellular matrix
GO:0005796	0.374	Golgi lumen
GO:0009986	0.366	cell surface
GO:0005783	0.341	endoplasmic reticulum
GO:0062023	0.316	collagen-containing extracellular matrix
GO:0031982	0.305	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	0.996	Serine endopeptidases.

[back to server]