StarFunc result for job id P29144

User Input

>input (1249 residues)
MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE
FTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQA
QDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C0U1	0.913	0.966	0.000	1179	0.943	0.999	A0A494C0U1.pdb.gz	A0A494C0U1_HUMAN Tripeptidyl-peptidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
2	AFDB:A0A494C1B8	0.917	0.975	0.000	1173	0.939	1.000	A0A494C1B8.pdb.gz	A0A494C1B8_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
3	AFDB:F4JVN6	0.926	0.841	0.000	1380	0.384	0.348	F4JVN6.pdb.gz	TPPII_ARATH Tripeptidyl-peptidase 2 OS=Arabidopsis thaliana OX=3702 GN=TPP2 PE=1 SV=1
4	AFDB:Q09541	0.921	0.840	0.000	1374	0.359	0.326	Q09541.pdb.gz	TPP2_CAEEL Tripeptidyl-peptidase 2 OS=Caenorhabditis elegans OX=6239 GN=tpp-2 PE=2 SV=1
5	AFDB:Q5VZU9	0.976	0.966	0.000	1262	0.999	0.989	Q5VZU9.pdb.gz	Q5VZU9_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
6	AFDB:Q9UT05	0.900	0.882	0.000	1274	0.338	0.331	Q9UT05.pdb.gz	TPP2_SCHPO Tripeptidyl-peptidase 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp2 PE=1 SV=1
7	AFDB:Q9V6K1	0.929	0.808	0.000	1441	0.386	0.334	Q9V6K1.pdb.gz	TPP2_DROME Tripeptidyl-peptidase 2 OS=Drosophila melanogaster OX=7227 GN=TppII PE=1 SV=2
8	PDB:3lxuX	0.844	0.865	6.922E-92	1217	0.346	0.355	3lxuX.pdb.gz
9	AFDB:Q5JIZ5	0.178	0.328	1.298E-13	663	0.089	0.167	Q5JIZ5.pdb.gz	TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1689 PE=1 SV=1
10	AFDB:Q1LWH3	0.208	0.238	2.307E-12	1074	0.070	0.081	Q1LWH3.pdb.gz	Q1LWH3_DANRE Membrane-bound transcription factor peptidase, site 1 OS=Danio rerio OX=7955 GN=goz1 PE=1 SV=1
11	AFDB:F4JJL8	0.225	0.355	2.616E-11	761	0.064	0.105	F4JJL8.pdb.gz	SBT3F_ARATH Subtilisin-like protease SBT3.15 OS=Arabidopsis thaliana OX=3702 GN=SBT3.15 PE=2 SV=2
12	PDB:1r6vA	0.173	0.307	3.907E-11	671	0.078	0.146	1r6vA.pdb.gz	Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
13	PDB:2x8jD	0.157	0.587	7.730E-7	308	0.049	0.198	2x8jD.pdb.gz
14	PDB:6h03A	0.091	0.093	3.566E-6	1223	0.065	0.066	6h03A.pdb.gz
15	PDB:6u3xB	0.165	0.384	5.110E-6	486	0.058	0.148	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
16	PDB:7q5zA	0.075	0.071	3.696E-5	1344	0.046	0.043	7q5zA.pdb.gz
17	PDB:4zelA	0.059	0.102	7.255E-5	550	0.035	0.080	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
18	PDB:4ziqA	0.081	0.073	1.302E-4	1450	0.073	0.063	4ziqA.pdb.gz
19	PDB:7nycA	0.072	0.063	6.004E-4	1542	0.067	0.054	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4lnvA	0.065	0.064	2.314E-3	1276	0.078	0.077	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0U1	0.0	1586	1179	0.609	0.645	A0A494C0U1_HUMAN Tripeptidyl-peptidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
2	A0A494C1B8	0.0	2370	1173	0.926	0.986	A0A494C1B8_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
3	F4JVN6	0.0	832	1380	0.393	0.356	TPPII_ARATH Tripeptidyl-peptidase 2 OS=Arabidopsis thaliana OX=3702 GN=TPP2 PE=1 SV=1
4	P29144	0.0	2605	1249	1.000	1.000	TPP2_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4
5	Q09541	0.0	749	1374	0.374	0.340	TPP2_CAEEL Tripeptidyl-peptidase 2 OS=Caenorhabditis elegans OX=6239 GN=tpp-2 PE=2 SV=1
6	Q5VZU9	0.0	2596	1262	1.000	0.990	Q5VZU9_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
7	Q64560	0.0	2546	1249	0.968	0.968	TPP2_RAT Tripeptidyl-peptidase 2 OS=Rattus norvegicus OX=10116 GN=Tpp2 PE=2 SV=3
8	Q9UT05	0.0	722	1274	0.328	0.322	TPP2_SCHPO Tripeptidyl-peptidase 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp2 PE=1 SV=1
9	Q9V6K1	0.0	763	1441	0.335	0.290	TPP2_DROME Tripeptidyl-peptidase 2 OS=Drosophila melanogaster OX=7227 GN=TppII PE=1 SV=2
10	A0A494C0A3	2.62e-152	457	217	0.174	1.000	A0A494C0A3_HUMAN Tripeptidyl peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
11	A0A494C1S6	7.55e-79	256	124	0.099	1.000	A0A494C1S6_HUMAN Tripeptidyl peptidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
12	Q5JIZ5	4.58e-17	89.0	663	0.074	0.139	TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1689 PE=1 SV=1
13	Q9WTZ3	7.79e-10	65.9	1052	0.054	0.065	MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus OX=10116 GN=Mbtps1 PE=1 SV=2
14	Q9WTZ2	9.39e-10	65.9	1052	0.054	0.065	MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus OX=10090 GN=Mbtps1 PE=1 SV=1
15	Q14703	9.63e-10	65.9	1052	0.054	0.064	MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens OX=9606 GN=MBTPS1 PE=1 SV=1
16	Q9Z2A8	9.96e-10	65.5	1052	0.054	0.065	MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus OX=10029 GN=MBTPS1 PE=1 SV=2
17	Q0WUG6	3.23e-08	60.8	1038	0.058	0.070	SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana OX=3702 GN=SBT6.1 PE=1 SV=1
18	P00782	1.22e-07	57.8	382	0.069	0.225	SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens OX=1390 GN=apr PE=1 SV=1
19	Q93LQ6	1.33e-07	58.5	699	0.064	0.114	FLS_FERPE Fervidolysin OS=Fervidobacterium pennivorans OX=93466 GN=fls PE=1 SV=1
20	Q1LWH3	1.57e-07	58.5	1074	0.052	0.061	Q1LWH3_DANRE Membrane-bound transcription factor peptidase, site 1 OS=Danio rerio OX=7955 GN=goz1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00082 Peptidase_S8	2.4e-64	228.9	Subtilase family
2	PF12580 TPPII	2.2e-69	244.3	Tripeptidyl peptidase II
3	PF12583 TPPII_N	1.3e+02	14.6	Tripeptidyl peptidase II N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013514

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001660	0.783	Inositol-3-phosphate synthase 1
2	60711.ENSCSAP00000005143	0.710	Programmed cell death 1 ligand 2
3	60711.ENSCSAP00000004143	0.704	annotation not available
4	60711.ENSCSAP00000006936	0.701	Hepatitis A virus cellular receptor 2
5	60711.ENSCSAP00000007452	0.700	Legumain
6	60711.ENSCSAP00000005822	0.693	TAP binding protein (tapasin)
7	60711.ENSCSAP00000006510	0.693	Inducible T-cell co-stimulator
8	60711.ENSCSAP00000005667	0.681	Protein disulfide isomerase family A, member 3
9	60711.ENSCSAP00000000211	0.679	Glutamyl aminopeptidase (aminopeptidase A)
10	60711.ENSCSAP00000010420	0.667	Aminopeptidase
11	60711.ENSCSAP00000003099	0.665	Belongs to the peptidase C1 family.
12	60711.ENSCSAP00000004484	0.649	Dipeptidyl-peptidase 3
13	60711.ENSCSAP00000002041	0.644	Programmed cell death 1
14	60711.ENSCSAP00000007551	0.644	Acts as a tumor suppressor in many tumor types
15	60711.ENSCSAP00000001701	0.633	IFI30, lysosomal thiol reductase
16	60711.ENSCSAP00000013166	0.623	Aminopeptidase
17	60711.ENSCSAP00000010890	0.590	annotation not available
18	60711.ENSCSAP00000010443	0.577	Aminopeptidase
19	60711.ENSCSAP00000005863	0.569	Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system
20	60711.ENSCSAP00000015435	0.563	Aminopeptidase puromycin sensitive

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008240	1.000	tripeptidyl-peptidase activity
GO:0005515	0.996	protein binding
GO:0042802	0.942	identical protein binding
GO:0004175	0.907	endopeptidase activity
GO:0004177	0.859	aminopeptidase activity
GO:0033218	0.708	amide binding
GO:0043167	0.341	ion binding
GO:0042277	0.312	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0019538	0.977	protein metabolic process
GO:0006508	0.452	proteolysis
GO:0009987	0.421	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016604	1.000	nuclear body
GO:0016020	0.429	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.14.9	1.000	tripeptidyl-peptidase I.
EC:3.4.14.10	1.000	tripeptidyl-peptidase II.
EC:3.4.11.-	0.859	Aminopeptidases.

[back to server]