StarFunc result for job id P29279

User Input

>input (349 residues)
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29279	1.000	1.000	3.671E-68	349	1.000	1.000	P29279.pdb.gz	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
2	AFDB:Q98TQ8	0.632	0.641	1.843E-58	344	0.868	0.881	Q98TQ8.pdb.gz	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
3	AFDB:Q5RI33	0.508	0.512	1.084E-53	345	0.768	0.777	Q5RI33.pdb.gz	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
4	AFDB:A0A024R9J4	0.443	0.434	2.255E-40	357	0.490	0.479	A0A024R9J4.pdb.gz
5	AFDB:Q64299	0.433	0.428	1.883E-39	354	0.493	0.486	Q64299.pdb.gz	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
6	AFDB:O00622	0.432	0.404	1.491E-38	381	0.501	0.459	O00622.pdb.gz	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
7	AFDB:O54775	0.429	0.411	7.723E-38	367	0.418	0.398	O54775.pdb.gz	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
8	AFDB:O95388	0.472	0.452	1.903E-37	367	0.424	0.403	O95388.pdb.gz	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
9	AFDB:Q6PFL2	0.382	0.335	2.701E-36	400	0.418	0.365	Q6PFL2.pdb.gz
10	AFDB:D0E2W2	0.407	0.419	3.875E-33	338	0.367	0.379	D0E2W2.pdb.gz	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
11	PDB:2k8pA	0.166	0.273	5.736E-3	189	0.086	0.159	2k8pA.pdb.gz
12	PDB:5ffoG	0.151	0.172	4.307E-2	297	0.049	0.057	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
13	PDB:1wq8A	0.122	0.323	5.050E-2	100	0.040	0.140	1wq8A.pdb.gz
14	PDB:5hk5F	0.103	0.242	5.326E-2	129	0.072	0.194	5hk5F.pdb.gz
15	PDB:5vqfB	0.151	0.163	6.944E-2	320	0.066	0.072	5vqfB.pdb.gz
16	PDB:5nxsA	0.137	0.161	8.142E-2	290	0.054	0.066	5nxsA.pdb.gz
17	PDB:7wrqB	0.136	0.265	8.585E-2	167	0.095	0.198	7wrqB.pdb.gz
18	PDB:7odrD	0.085	0.109	1.384E-1	240	0.046	0.067	7odrD.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
19	PDB:4my2A	0.097	0.073	1.459E-1	474	0.043	0.032	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
20	PDB:7jg2J	0.088	0.177	1.804E-1	132	0.072	0.189	7jg2J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29268	0.0	640	348	0.908	0.911	CCN2_MOUSE CCN family member 2 OS=Mus musculus OX=10090 GN=Ccn2 PE=1 SV=3
2	P29279	0.0	710	349	1.000	1.000	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
3	Q5RI33	0.0	565	345	0.768	0.777	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
4	Q98TQ8	0.0	612	344	0.848	0.860	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
5	Q9R1E9	0.0	640	347	0.911	0.916	CCN2_RAT CCN family member 2 OS=Rattus norvegicus OX=10116 GN=Ccn2 PE=2 SV=1
6	P48745	6.59e-119	349	357	0.484	0.473	CCN3_HUMAN CCN family member 3 OS=Homo sapiens OX=9606 GN=CCN3 PE=1 SV=1
7	Q64299	2.78e-113	335	354	0.499	0.492	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
8	Q9QZQ5	6.63e-113	333	351	0.470	0.467	CCN3_RAT CCN family member 3 OS=Rattus norvegicus OX=10116 GN=Ccn3 PE=1 SV=1
9	Q9ES72	6.69e-102	306	379	0.501	0.462	CCN1_RAT CCN family member 1 OS=Rattus norvegicus OX=10116 GN=Ccn1 PE=2 SV=1
10	F1QL10	1.14e-101	306	369	0.461	0.436	F1QL10_DANRE Cellular communication network factor 1 OS=Danio rerio OX=7955 GN=cyr61 PE=3 SV=1
11	O00622	4.66e-101	305	381	0.501	0.459	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
12	P18406	8.40e-101	304	379	0.501	0.462	CCN1_MOUSE CCN family member 1 OS=Mus musculus OX=10090 GN=Ccn1 PE=1 SV=1
13	O95388	3.60e-98	296	367	0.453	0.431	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
14	Q99PP0	1.48e-97	295	367	0.424	0.403	CCN4_RAT CCN family member 4 OS=Rattus norvegicus OX=10116 GN=Ccn4 PE=2 SV=1
15	O54775	1.76e-97	295	367	0.424	0.403	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
16	A0A384NYW3	4.27e-78	245	354	0.378	0.373	A0A384NYW3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
17	O95389	4.27e-78	245	354	0.378	0.373	CCN6_HUMAN Cellular communication network factor 6 OS=Homo sapiens OX=9606 GN=CCN6 PE=1 SV=1
18	D0E2W2	9.66e-76	238	338	0.370	0.382	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
19	Q9Z0G4	8.40e-61	197	251	0.312	0.434	CCN5_MOUSE CCN family member 5 OS=Mus musculus OX=10090 GN=Ccn5 PE=2 SV=1
20	Q9JHC6	1.12e-54	181	250	0.298	0.416	CCN5_RAT CCN family member 5 OS=Rattus norvegicus OX=10116 GN=Ccn5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	1.5e-13	62.3	Cystine-knot domain
2	PF00219 IGFBP	3.9e-07	41.9	Insulin-like growth factor binding protein
3	PF19035 TSP1_CCN	6.4e-16	69.7	CCN3 Nov like TSP1 domain
4	PF00090 TSP_1	0.11	24.0	Thrombospondin type 1 domain
5	PF00093 VWC	2.6e-07	42.2	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346839	0.993	Fibronectin type III domain containing
2	9606.ENSP00000221930	0.987	Transforming growth factor beta-1
3	9606.ENSP00000478570	0.986	Vascular endothelial growth factor A
4	9606.ENSP00000245451	0.984	Bone morphogenetic protein 4
5	9606.ENSP00000478927	0.983	Transcriptional coactivator YAP1
6	9606.ENSP00000238682	0.975	Transforming growth factor beta-3
7	9606.ENSP00000419465	0.973	WW domain-containing transcription regulator protein 1
8	9606.ENSP00000435233	0.970	Transcriptional enhancer factor TEF-1
9	9606.ENSP00000351905	0.965	TGF-beta receptor type-2
10	9606.ENSP00000243077	0.963	Prolow-density lipoprotein receptor-related protein 1
11	9606.ENSP00000352926	0.962	Transcriptional enhancer factor TEF-3
12	9606.ENSP00000261349	0.959	Low-density lipoprotein receptor-related protein 6
13	9606.ENSP00000431418	0.951	High affinity nerve growth factor receptor
14	9606.ENSP00000472109	0.951	Transcriptional enhancer factor TEF-4
15	9606.ENSP00000345772	0.949	Transcriptional enhancer factor TEF-5
16	9606.ENSP00000441691	0.948	Integrin alpha-M
17	9606.ENSP00000212355	0.938	Transforming growth factor beta receptor type 3
18	9606.ENSP00000380948	0.923	Integrin beta-2
19	9606.ENSP00000368104	0.882	Bone morphogenetic protein 2
20	9606.ENSP00000379350	0.868	Integrin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	0.999	growth factor binding
GO:0005102	0.998	signaling receptor binding
GO:0005520	0.993	insulin-like growth factor binding
GO:0005539	0.726	glycosaminoglycan binding
GO:1901681	0.717	sulfur compound binding
GO:0140677	0.533	molecular function activator activity
GO:0044877	0.411	protein-containing complex binding
GO:0030545	0.346	signaling receptor regulator activity
GO:0048018	0.336	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.996	cellular process
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0019222	0.977	regulation of metabolic process
GO:0007275	0.976	multicellular organism development
GO:0048513	0.959	animal organ development
GO:0048518	0.958	positive regulation of biological process
GO:0023052	0.950	signaling
GO:0051239	0.940	regulation of multicellular organismal process
GO:0048869	0.913	cellular developmental process
GO:0007155	0.903	cell adhesion
GO:0030154	0.895	cell differentiation
GO:0050793	0.878	regulation of developmental process
GO:0065009	0.865	regulation of molecular function
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0080090	0.843	regulation of primary metabolic process
GO:0051171	0.843	regulation of nitrogen compound metabolic process
GO:0031323	0.834	regulation of cellular metabolic process
GO:0051716	0.823	cellular response to stimulus
GO:0042221	0.821	response to chemical
GO:0007154	0.821	cell communication
GO:0048584	0.818	positive regulation of response to stimulus
GO:2000026	0.817	regulation of multicellular organismal development
GO:0048731	0.813	system development
GO:0048523	0.813	negative regulation of cellular process
GO:0010468	0.811	regulation of gene expression
GO:0023056	0.810	positive regulation of signaling
GO:0009888	0.806	tissue development
GO:0010604	0.805	positive regulation of macromolecule metabolic process
GO:0048522	0.793	positive regulation of cellular process
GO:0042127	0.761	regulation of cell population proliferation
GO:0010646	0.754	regulation of cell communication
GO:0007165	0.752	signal transduction
GO:0009966	0.737	regulation of signal transduction
GO:0051240	0.731	positive regulation of multicellular organismal process
GO:0043408	0.720	regulation of MAPK cascade
GO:0010647	0.717	positive regulation of cell communication
GO:0051130	0.713	positive regulation of cellular component organization
GO:0006950	0.707	response to stress
GO:0051094	0.695	positive regulation of developmental process
GO:0045595	0.686	regulation of cell differentiation
GO:0051246	0.678	regulation of protein metabolic process
GO:0009653	0.639	anatomical structure morphogenesis
GO:0044087	0.625	regulation of cellular component biogenesis
GO:0009967	0.616	positive regulation of signal transduction
GO:0051173	0.577	positive regulation of nitrogen compound metabolic process
GO:1902533	0.558	positive regulation of intracellular signal transduction
GO:0007166	0.552	cell surface receptor signaling pathway
GO:0009889	0.551	regulation of biosynthetic process
GO:0040012	0.540	regulation of locomotion
GO:0008152	0.520	metabolic process
GO:0009719	0.488	response to endogenous stimulus
GO:0050790	0.479	regulation of catalytic activity
GO:0032970	0.476	regulation of actin filament-based process
GO:0009892	0.449	negative regulation of metabolic process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0031326	0.431	regulation of cellular biosynthetic process
GO:0045597	0.431	positive regulation of cell differentiation
GO:0033043	0.430	regulation of organelle organization
GO:1902903	0.429	regulation of supramolecular fiber organization
GO:0019219	0.428	regulation of nucleobase-containing compound metabolic process
GO:0030334	0.385	regulation of cell migration
GO:0071840	0.380	cellular component organization or biogenesis
GO:0080134	0.379	regulation of response to stress
GO:0009891	0.379	positive regulation of biosynthetic process
GO:0010605	0.373	negative regulation of macromolecule metabolic process
GO:0110020	0.371	regulation of actomyosin structure organization
GO:0010556	0.366	regulation of macromolecule biosynthetic process
GO:0051252	0.359	regulation of RNA metabolic process
GO:0016043	0.341	cellular component organization
GO:0051247	0.340	positive regulation of protein metabolic process
GO:2001141	0.337	regulation of RNA biosynthetic process
GO:0010033	0.322	response to organic substance
GO:1903506	0.318	regulation of nucleic acid-templated transcription
GO:0006355	0.313	regulation of DNA-templated transcription
GO:0042325	0.311	regulation of phosphorylation
GO:0044089	0.309	positive regulation of cellular component biogenesis
GO:0044237	0.301	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.962	cell periphery
GO:0005615	0.916	extracellular space
GO:0043227	0.898	membrane-bounded organelle
GO:0043229	0.897	intracellular organelle
GO:0043231	0.885	intracellular membrane-bounded organelle
GO:0005737	0.857	cytoplasm
GO:0030312	0.744	external encapsulating structure
GO:0031012	0.718	extracellular matrix
GO:0016020	0.711	membrane
GO:0070013	0.683	intracellular organelle lumen
GO:0005886	0.573	plasma membrane
GO:0062023	0.400	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]