StarFunc result for job id P29317

User Input

>input (976 residues)
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.418	0.363	0.000	1130	0.498	0.430	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.411	0.407	0.000	986	0.484	0.479	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.425	0.395	0.000	1055	0.466	0.431	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:D3ZDH4	0.407	0.407	0.000	977	0.480	0.479	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
5	AFDB:F1Q9D9	0.410	0.415	0.000	963	0.492	0.498	F1Q9D9.pdb.gz
6	AFDB:F1RCL1	0.453	0.453	0.000	976	0.476	0.476	F1RCL1.pdb.gz
7	AFDB:O08680	0.393	0.390	0.000	984	0.506	0.502	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
8	AFDB:P21709	0.420	0.420	0.000	976	0.491	0.491	P21709.pdb.gz	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
9	AFDB:P29322	0.415	0.404	0.000	1005	0.473	0.460	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
10	AFDB:P29323	0.415	0.385	0.000	1055	0.487	0.450	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
11	PDB:2h8hA	0.246	0.514	2.176E-22	445	0.139	0.306	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.255	0.439	1.440E-20	555	0.115	0.202	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.253	0.436	3.675E-20	551	0.107	0.189	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.244	0.527	9.855E-20	441	0.100	0.222	1k9aB.pdb.gz
15	PDB:8dksA	0.212	0.665	1.925E-14	283	0.077	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.239	0.805	1.136E-13	269	0.058	0.212	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6uanB	0.217	0.752	2.628E-13	261	0.085	0.318	6uanB.pdb.gz
18	PDB:4rerA	0.234	0.476	3.899E-13	459	0.085	0.181	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6lk5A	0.238	0.814	6.386E-13	265	0.067	0.245	6lk5A.pdb.gz
20	PDB:2qkwB	0.221	0.671	8.585E-13	292	0.079	0.264	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	958	1130	0.504	0.435	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	888	965	0.480	0.485	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	982	983	0.507	0.504	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	872	1055	0.473	0.438	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	900	946	0.471	0.486	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	915	986	0.487	0.482	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	944	918	0.489	0.520	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	635	1005	0.380	0.369	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	900	977	0.492	0.491	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	967	949	0.506	0.521	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	918	987	0.486	0.480	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	649	1014	0.401	0.386	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	980	984	0.507	0.503	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	905	1004	0.465	0.452	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	653	1021	0.398	0.380	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	786	987	0.461	0.456	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	781	976	0.456	0.456	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	636	1019	0.392	0.376	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	907	984	0.489	0.485	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	908	976	0.498	0.498	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.15	22.7	ABC1 atypical kinase-like domain
2	PF14575 EphA2_TM	1e-17	75.9	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	2.6e-59	211.8	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	2.6	19.2	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	1.1e-30	117.2	Fibronectin type III domain
6	PF12330 Haspin_kinase	1.6e+02	12.6	Haspin like kinase domain
7	PF09294 Interfer-bind	0.00034	32.2	Interferon-alpha/beta receptor, fibronectin type III
8	PF06293 Kdo	6.4e+02	11.1	Lipopolysaccharide kinase (Kdo/WaaP) family
9	PF10179 NDNF	3.1e+02	12.9	Neuron-derived neurotrophic factor, first Fn(III) domain
10	PF00069 Pkinase	1.1e-43	161.1	Protein kinase domain
11	PF17667 Pkinase_fungal	7e+02	10.3	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	2.2e-95	330.4	Protein tyrosine and serine/threonine kinase
13	PF16656 Pur_ac_phosph_N	1.3e-07	43.5	Purple acid Phosphatase, N-terminal domain
14	PF00536 SAM_1	1.1e-17	75.5	SAM domain (Sterile alpha motif)
15	PF07647 SAM_2	2.6e-10	51.6	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351209

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328777	0.999	Ephrin-A5
2	9606.ENSP00000357392	0.999	Ephrin-A1
3	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
4	9606.ENSP00000298229	0.998	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
5	9606.ENSP00000215368	0.997	Ephrin-A2
6	9606.ENSP00000401303	0.996	SHC-transforming protein 1
7	9606.ENSP00000376345	0.988	Growth factor receptor-bound protein 2
8	9606.ENSP00000272067	0.986	Low molecular weight phosphotyrosine protein phosphatase
9	9606.ENSP00000414378	0.986	Ephrin-A4
10	9606.ENSP00000275815	0.980	Ephrin type-A receptor 1
11	9606.ENSP00000359073	0.979	Guanine nucleotide exchange factor VAV3
12	9606.ENSP00000367629	0.976	Rho guanine nucleotide exchange factor 16
13	9606.ENSP00000261769	0.969	Cadherin-1
14	9606.ENSP00000344456	0.969	Catenin beta-1
15	9606.ENSP00000400175	0.955	Transforming protein RhoA
16	9606.ENSP00000341189	0.954	Focal adhesion kinase 1
17	9606.ENSP00000391669	0.952	Breast cancer anti-estrogen resistance protein 1
18	9606.ENSP00000245323	0.950	Ephrin-B2
19	9606.ENSP00000357393	0.948	Ephrin-A3
20	9606.ENSP00000360916	0.947	Guanine nucleotide exchange factor VAV2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0044877	0.621	protein-containing complex binding
GO:0005003	0.535	ephrin receptor activity
GO:0005102	0.360	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0032501	0.977	multicellular organismal process
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0032502	0.951	developmental process
GO:0048856	0.943	anatomical structure development
GO:0007169	0.937	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048731	0.933	system development
GO:0048518	0.905	positive regulation of biological process
GO:0048522	0.874	positive regulation of cellular process
GO:0048013	0.859	ephrin receptor signaling pathway
GO:0048870	0.858	cell motility
GO:0048519	0.799	negative regulation of biological process
GO:0048513	0.788	animal organ development
GO:0008152	0.771	metabolic process
GO:0022603	0.768	regulation of anatomical structure morphogenesis
GO:0044237	0.754	cellular metabolic process
GO:0048583	0.753	regulation of response to stimulus
GO:0030334	0.746	regulation of cell migration
GO:0019222	0.739	regulation of metabolic process
GO:0048869	0.727	cellular developmental process
GO:0051239	0.713	regulation of multicellular organismal process
GO:0009653	0.705	anatomical structure morphogenesis
GO:0065009	0.673	regulation of molecular function
GO:0071704	0.641	organic substance metabolic process
GO:2000026	0.617	regulation of multicellular organismal development
GO:0001944	0.611	vasculature development
GO:0006793	0.584	phosphorus metabolic process
GO:0009888	0.583	tissue development
GO:0060255	0.581	regulation of macromolecule metabolic process
GO:0044238	0.534	primary metabolic process
GO:0050790	0.512	regulation of catalytic activity
GO:0035239	0.510	tube morphogenesis
GO:0023051	0.503	regulation of signaling
GO:0010646	0.496	regulation of cell communication
GO:0060429	0.478	epithelium development
GO:0009966	0.461	regulation of signal transduction
GO:0051128	0.452	regulation of cellular component organization
GO:0048523	0.451	negative regulation of cellular process
GO:0080090	0.449	regulation of primary metabolic process
GO:0048646	0.442	anatomical structure formation involved in morphogenesis
GO:0040017	0.437	positive regulation of locomotion
GO:0051171	0.434	regulation of nitrogen compound metabolic process
GO:1902531	0.429	regulation of intracellular signal transduction
GO:0030335	0.415	positive regulation of cell migration
GO:0042221	0.414	response to chemical
GO:0006807	0.396	nitrogen compound metabolic process
GO:0031323	0.396	regulation of cellular metabolic process
GO:0042127	0.393	regulation of cell population proliferation
GO:0071840	0.391	cellular component organization or biogenesis
GO:0009893	0.388	positive regulation of metabolic process
GO:0010604	0.375	positive regulation of macromolecule metabolic process
GO:0051246	0.371	regulation of protein metabolic process
GO:0048584	0.361	positive regulation of response to stimulus
GO:0016043	0.358	cellular component organization
GO:0044093	0.356	positive regulation of molecular function
GO:0030155	0.356	regulation of cell adhesion
GO:0030154	0.356	cell differentiation
GO:0010468	0.348	regulation of gene expression
GO:0043170	0.340	macromolecule metabolic process
GO:0051173	0.333	positive regulation of nitrogen compound metabolic process
GO:1901564	0.326	organonitrogen compound metabolic process
GO:0019538	0.324	protein metabolic process
GO:0023056	0.312	positive regulation of signaling
GO:0051336	0.307	regulation of hydrolase activity
GO:0010647	0.305	positive regulation of cell communication
GO:0006796	0.303	phosphate-containing compound metabolic process
GO:0007399	0.302	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.895	extracellular region
GO:0005737	0.817	cytoplasm
GO:0043226	0.773	organelle
GO:0043227	0.761	membrane-bounded organelle
GO:0043231	0.714	intracellular membrane-bounded organelle
GO:0005829	0.553	cytosol
GO:0030054	0.534	cell junction
GO:0009986	0.387	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]