StarFunc result for job id P29320

User Input

>input (983 residues)
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.443	0.390	0.000	1130	0.624	0.542	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.494	0.493	0.000	986	0.558	0.557	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.424	0.401	0.000	1055	0.540	0.503	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:D3ZDH4	0.389	0.391	0.000	977	0.436	0.439	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
5	AFDB:F1Q9D9	0.650	0.662	0.000	963	0.792	0.809	F1Q9D9.pdb.gz
6	AFDB:F1RCL1	0.429	0.432	0.000	976	0.610	0.615	F1RCL1.pdb.gz
7	AFDB:O08680	0.529	0.528	0.000	984	0.957	0.956	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
8	AFDB:O15197	0.389	0.376	0.000	1021	0.413	0.398	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
9	AFDB:O73875	0.379	0.378	0.000	987	0.480	0.478	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
10	AFDB:O73878	0.375	0.378	0.000	976	0.482	0.486	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
11	PDB:2h8hA	0.239	0.505	1.872E-22	445	0.138	0.306	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.247	0.539	4.029E-21	441	0.105	0.234	1k9aB.pdb.gz
13	PDB:4fl2A	0.247	0.430	8.465E-21	555	0.105	0.186	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.250	0.436	6.131E-20	551	0.106	0.189	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.219	0.696	1.350E-15	283	0.071	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:4rerA	0.234	0.480	1.861E-14	459	0.079	0.170	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:6s73A	0.236	0.799	2.383E-14	269	0.066	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:6b1uA	0.234	0.495	2.765E-14	442	0.081	0.181	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:6uanB	0.215	0.750	3.721E-14	261	0.090	0.337	6uanB.pdb.gz
20	PDB:2qkwB	0.236	0.728	3.910E-14	292	0.069	0.233	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1313	1130	0.632	0.550	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1071	965	0.545	0.555	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	2052	983	1.000	1.000	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1109	1055	0.540	0.503	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1119	946	0.547	0.569	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1136	986	0.557	0.556	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1914	918	0.932	0.998	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	707	1005	0.404	0.395	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	781	977	0.438	0.441	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1261	949	0.613	0.635	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	E7EU71	623	547	0.286	0.514	E7EU71_HUMAN EPH receptor A6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
12	F1MAJ0	1134	987	0.558	0.556	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
13	O08644	786	1014	0.421	0.408	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
14	O08680	1934	984	0.957	0.956	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
15	O09127	1180	1004	0.561	0.549	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
16	O15197	761	1021	0.405	0.390	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
17	O73875	899	987	0.485	0.483	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
18	O73878	913	976	0.491	0.495	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
19	O96435	697	1019	0.409	0.395	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
20	P09759	1146	984	0.556	0.556	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.84	20.2	ABC1 atypical kinase-like domain
2	PF14575 EphA2_TM	1.5e-18	78.6	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	1.2e-66	235.7	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	0.0015	29.5	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	1.8e-27	106.8	Fibronectin type III domain
6	PF16893 fn3_2	2.4	19.7	Fibronectin type III domain
7	PF12330 Haspin_kinase	2.5e+02	12.0	Haspin like kinase domain
8	PF09294 Interfer-bind	1.4e+02	14.2	Interferon-alpha/beta receptor, fibronectin type III
9	PF06293 Kdo	64	14.4	Lipopolysaccharide kinase (Kdo/WaaP) family
10	PF10179 NDNF	1.7e+02	13.7	Neuron-derived neurotrophic factor, first Fn(III) domain
11	PF00069 Pkinase	4e-45	165.8	Protein kinase domain
12	PF17667 Pkinase_fungal	2.6e+02	11.7	Fungal protein kinase
13	PF07714 PK_Tyr_Ser-Thr	4.6e-96	332.7	Protein tyrosine and serine/threonine kinase
14	PF16656 Pur_ac_phosph_N	0.0014	30.5	Purple acid Phosphatase, N-terminal domain
15	PF00536 SAM_1	9.4e-09	46.9	SAM domain (Sterile alpha motif)
16	PF07647 SAM_2	3e-09	48.2	SAM domain (Sterile alpha motif)
17	PF14292 SusE	4.4e+02	12.6	SusE outer membrane protein
18	PF15102 TMEM154	5.8e+02	11.7	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328777	0.999	Ephrin-A5
2	9606.ENSP00000215368	0.998	Ephrin-A2
3	9606.ENSP00000357392	0.995	Ephrin-A1
4	9606.ENSP00000245323	0.987	Ephrin-B2
5	9606.ENSP00000260408	0.983	Disintegrin and metalloproteinase domain-containing protein 10
6	9606.ENSP00000358309	0.967	Ephrin type-A receptor 7
7	9606.ENSP00000300574	0.950	Adapter molecule crk
8	9606.ENSP00000264051	0.947	Ephexin-1
9	9606.ENSP00000362680	0.938	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000357393	0.936	Ephrin-A3
11	9606.ENSP00000400175	0.935	Transforming protein RhoA
12	9606.ENSP00000346671	0.933	Tyrosine-protein kinase Fyn
13	9606.ENSP00000264033	0.922	E3 ubiquitin-protein ligase CBL
14	9606.ENSP00000462468	0.908	Tyrosine-protein kinase Yes
15	9606.ENSP00000428924	0.907	Tyrosine-protein kinase Lyn
16	9606.ENSP00000275815	0.906	Ephrin type-A receptor 1
17	9606.ENSP00000337825	0.906	Tyrosine-protein kinase Lck
18	9606.ENSP00000374323	0.906	Ephrin type-A receptor 6
19	9606.ENSP00000444986	0.906	Tyrosine-protein kinase HCK
20	9606.ENSP00000351209	0.905	Ephrin type-A receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	1.000	ephrin receptor activity
GO:0005102	0.314	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.986	response to stimulus
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0007165	0.965	signal transduction
GO:0032501	0.954	multicellular organismal process
GO:0048519	0.952	negative regulation of biological process
GO:0048518	0.943	positive regulation of biological process
GO:0048731	0.936	system development
GO:0048013	0.930	ephrin receptor signaling pathway
GO:0031344	0.916	regulation of cell projection organization
GO:0048583	0.905	regulation of response to stimulus
GO:0048522	0.896	positive regulation of cellular process
GO:0044087	0.867	regulation of cellular component biogenesis
GO:0008152	0.861	metabolic process
GO:0071704	0.842	organic substance metabolic process
GO:0042221	0.814	response to chemical
GO:0044237	0.804	cellular metabolic process
GO:0048523	0.798	negative regulation of cellular process
GO:0016310	0.788	phosphorylation
GO:0007399	0.765	nervous system development
GO:1903034	0.762	regulation of response to wounding
GO:0044238	0.753	primary metabolic process
GO:0010977	0.747	negative regulation of neuron projection development
GO:0016043	0.746	cellular component organization
GO:0040012	0.745	regulation of locomotion
GO:0016477	0.726	cell migration
GO:0043170	0.724	macromolecule metabolic process
GO:0070887	0.704	cellular response to chemical stimulus
GO:0048679	0.686	regulation of axon regeneration
GO:0006807	0.677	nitrogen compound metabolic process
GO:0065008	0.672	regulation of biological quality
GO:0048585	0.671	negative regulation of response to stimulus
GO:0048468	0.654	cell development
GO:0006950	0.635	response to stress
GO:0070571	0.635	negative regulation of neuron projection regeneration
GO:0071310	0.633	cellular response to organic substance
GO:1901564	0.598	organonitrogen compound metabolic process
GO:0043412	0.595	macromolecule modification
GO:0009605	0.587	response to external stimulus
GO:0019538	0.585	protein metabolic process
GO:1901700	0.565	response to oxygen-containing compound
GO:0030030	0.546	cell projection organization
GO:0065009	0.544	regulation of molecular function
GO:0008037	0.540	cell recognition
GO:0120036	0.536	plasma membrane bounded cell projection organization
GO:0048666	0.528	neuron development
GO:0051707	0.510	response to other organism
GO:0019222	0.481	regulation of metabolic process
GO:0060255	0.443	regulation of macromolecule metabolic process
GO:0010646	0.442	regulation of cell communication
GO:0036211	0.434	protein modification process
GO:0023051	0.431	regulation of signaling
GO:0033993	0.425	response to lipid
GO:0032879	0.424	regulation of localization
GO:0030155	0.415	regulation of cell adhesion
GO:0031323	0.414	regulation of cellular metabolic process
GO:0009888	0.404	tissue development
GO:0009966	0.404	regulation of signal transduction
GO:0080090	0.398	regulation of primary metabolic process
GO:0051171	0.389	regulation of nitrogen compound metabolic process
GO:0050790	0.328	regulation of catalytic activity
GO:0045595	0.326	regulation of cell differentiation
GO:0009893	0.313	positive regulation of metabolic process
GO:1901888	0.311	regulation of cell junction assembly
GO:0051239	0.310	regulation of multicellular organismal process
GO:0001659	0.309	temperature homeostasis
GO:0002526	0.308	acute inflammatory response
GO:0051336	0.300	regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.990	endomembrane system
GO:0031974	0.967	membrane-enclosed lumen
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005737	0.887	cytoplasm
GO:0070013	0.885	intracellular organelle lumen
GO:0005634	0.881	nucleus
GO:0031981	0.816	nuclear lumen
GO:0005654	0.673	nucleoplasm
GO:0005829	0.640	cytosol
GO:0043228	0.466	non-membrane-bounded organelle
GO:0043232	0.352	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]