StarFunc result for job id P29322

User Input

>input (1005 residues)
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.414	0.371	0.000	1130	0.542	0.482	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.438	0.446	0.000	986	0.500	0.509	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.577	0.553	0.000	1055	0.494	0.470	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.549	0.568	0.000	963	0.529	0.552	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.763	0.785	0.000	976	0.559	0.576	F1RCL1.pdb.gz
6	AFDB:O08680	0.458	0.467	0.000	984	0.555	0.567	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O73875	0.514	0.520	0.000	987	0.436	0.444	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
8	AFDB:O73878	0.401	0.412	0.000	976	0.433	0.446	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
9	AFDB:P29322	1.000	1.000	0.000	1005	1.000	1.000	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
10	AFDB:P29323	0.519	0.497	0.000	1055	0.500	0.476	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
11	PDB:1k9aB	0.249	0.556	2.950E-21	441	0.109	0.249	1k9aB.pdb.gz
12	PDB:2h8hA	0.239	0.521	3.246E-21	445	0.131	0.297	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.242	0.431	8.252E-19	555	0.104	0.189	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.241	0.430	6.429E-18	551	0.100	0.183	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.215	0.700	2.606E-14	283	0.068	0.240	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:2qkwB	0.227	0.719	5.085E-14	292	0.068	0.233	2qkwB.pdb.gz
17	PDB:6b1uA	0.235	0.512	5.595E-14	442	0.073	0.165	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4zhxA	0.233	0.545	8.598E-14	409	0.065	0.159	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:4rerA	0.231	0.488	1.525E-13	459	0.065	0.142	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:5ufuA	0.233	0.597	1.846E-13	369	0.063	0.171	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1170	1130	0.554	0.493	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	986	965	0.489	0.509	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1190	983	0.552	0.565	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1028	1055	0.500	0.476	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1014	946	0.489	0.519	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1053	986	0.507	0.517	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1153	918	0.527	0.577	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	672	1005	0.385	0.385	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	714	977	0.398	0.409	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1147	949	0.540	0.572	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	E7EU71	546	547	0.240	0.441	E7EU71_HUMAN EPH receptor A6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
12	F1MAJ0	1048	987	0.508	0.518	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
13	O08644	727	1014	0.400	0.396	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
14	O08680	1186	984	0.551	0.563	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
15	O09127	1960	1004	0.950	0.951	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
16	O15197	723	1021	0.400	0.394	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
17	O73875	816	987	0.445	0.453	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
18	O73878	832	976	0.444	0.457	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
19	O96435	671	1019	0.399	0.394	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
20	P09759	1068	984	0.517	0.528	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.1e+02	13.4	ABC1 atypical kinase-like domain
2	PF11737 DUF3300	6.2e+02	11.3	Protein of unknown function (DUF3300)
3	PF14575 EphA2_TM	2.3e-12	58.8	Ephrin type-A receptor 2 transmembrane domain
4	PF01404 Ephrin_lbd	2.9e-62	221.4	Ephrin receptor ligand binding domain
5	PF07699 Ephrin_rec_like	5.7	18.1	Tyrosine-protein kinase ephrin type A/B receptor-like
6	PF00041 fn3	6e-27	105.1	Fibronectin type III domain
7	PF16893 fn3_2	0.0069	27.8	Fibronectin type III domain
8	PF12330 Haspin_kinase	4.4e+02	11.2	Haspin like kinase domain
9	PF09294 Interfer-bind	3.6e+02	12.9	Interferon-alpha/beta receptor, fibronectin type III
10	PF06293 Kdo	1.5	19.7	Lipopolysaccharide kinase (Kdo/WaaP) family
11	PF00069 Pkinase	1.9e-39	147.2	Protein kinase domain
12	PF07714 PK_Tyr_Ser-Thr	4.2e-89	309.8	Protein tyrosine and serine/threonine kinase
13	PF16656 Pur_ac_phosph_N	0.0023	29.9	Purple acid Phosphatase, N-terminal domain
14	PF00536 SAM_1	9.1e-16	69.4	SAM domain (Sterile alpha motif)
15	PF07647 SAM_2	4.7e-11	54.0	SAM domain (Sterile alpha motif)
16	PF14292 SusE	14	17.4	SusE outer membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000166244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328777	0.990	Ephrin-A5
2	9606.ENSP00000352121	0.971	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
3	9606.ENSP00000357392	0.903	Ephrin-A1
4	9606.ENSP00000480157	0.900	Phosphoinositide 3-kinase regulatory subunit 6
5	9606.ENSP00000414378	0.899	Ephrin-A4
6	9606.ENSP00000204961	0.881	Ephrin-B1
7	9606.ENSP00000226091	0.875	Ephrin-B3
8	9606.ENSP00000264051	0.874	Ephexin-1
9	9606.ENSP00000215368	0.861	Ephrin-A2
10	9606.ENSP00000357393	0.850	Ephrin-A3
11	9606.ENSP00000245323	0.838	Ephrin-B2
12	9606.ENSP00000274376	0.815	Ras GTPase-activating protein 1
13	9606.ENSP00000361423	0.813	Tyrosine-protein kinase ABL1
14	9606.ENSP00000260408	0.770	Disintegrin and metalloproteinase domain-containing protein 10
15	9606.ENSP00000332118	0.765	Ephrin type-B receptor 3
16	9606.ENSP00000350896	0.763	Ephrin type-B receptor 4
17	9606.ENSP00000467107	0.719	Ras and Rab interactor-like protein
18	9606.ENSP00000381097	0.689	Ephrin type-B receptor 1
19	9606.ENSP00000363763	0.687	Ephrin type-B receptor 2
20	9606.ENSP00000353518	0.655	Ankyrin repeat and SAM domain-containing protein 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005003	0.999	ephrin receptor activity
GO:0019838	0.815	growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.986	response to stimulus
GO:0007165	0.975	signal transduction
GO:0007166	0.968	cell surface receptor signaling pathway
GO:0007275	0.954	multicellular organism development
GO:0048013	0.948	ephrin receptor signaling pathway
GO:0048731	0.942	system development
GO:0048522	0.886	positive regulation of cellular process
GO:0030155	0.885	regulation of cell adhesion
GO:0051174	0.869	regulation of phosphorus metabolic process
GO:0071704	0.843	organic substance metabolic process
GO:0046777	0.834	protein autophosphorylation
GO:0050790	0.726	regulation of catalytic activity
GO:0048870	0.708	cell motility
GO:0023051	0.637	regulation of signaling
GO:0010646	0.637	regulation of cell communication
GO:0009653	0.607	anatomical structure morphogenesis
GO:0042325	0.522	regulation of phosphorylation
GO:0048583	0.491	regulation of response to stimulus
GO:0071840	0.484	cellular component organization or biogenesis
GO:0009966	0.457	regulation of signal transduction
GO:0016043	0.449	cellular component organization
GO:0080090	0.442	regulation of primary metabolic process
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0048519	0.396	negative regulation of biological process
GO:0007399	0.392	nervous system development
GO:0051171	0.366	regulation of nitrogen compound metabolic process
GO:0042221	0.355	response to chemical
GO:0048523	0.324	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.787	intracellular anatomical structure
GO:0005737	0.656	cytoplasm
GO:0043226	0.472	organelle
GO:0005829	0.344	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]