StarFunc result for job id P29323

User Input

>input (1055 residues)
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSE
YNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK
LPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYT
EKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTV
IQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTY
TSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTL
AGHQKKILNSIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKK
GMGKKKTDPGRGREIQGIFFKEDSHKESNDCSCGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.386	0.362	0.000	1130	0.507	0.473	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.481	0.513	0.000	986	0.924	0.989	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.506	0.506	0.000	1055	0.670	0.670	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.470	0.510	0.000	963	0.500	0.548	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.430	0.460	0.000	976	0.519	0.561	F1RCL1.pdb.gz
6	AFDB:O08680	0.414	0.440	0.000	984	0.518	0.555	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O15197	0.412	0.425	0.000	1021	0.437	0.452	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
8	AFDB:O73875	0.422	0.447	0.000	987	0.503	0.538	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
9	AFDB:O73878	0.471	0.504	0.000	976	0.482	0.522	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
10	AFDB:P29322	0.497	0.519	0.000	1005	0.472	0.496	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:2h8hA	0.227	0.509	1.060E-22	445	0.126	0.299	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.236	0.549	7.189E-21	441	0.099	0.236	1k9aB.pdb.gz
13	PDB:4fl2A	0.231	0.429	1.069E-20	555	0.095	0.180	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.233	0.436	5.776E-20	551	0.098	0.187	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.202	0.683	9.940E-15	283	0.065	0.244	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.221	0.794	1.130E-13	269	0.063	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:7mfdA	0.218	0.510	1.248E-13	410	0.087	0.224	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
18	PDB:6lk5A	0.219	0.807	1.766E-13	265	0.055	0.219	6lk5A.pdb.gz
19	PDB:6uanB	0.198	0.739	4.534E-13	261	0.083	0.337	6uanB.pdb.gz
20	PDB:4rerA	0.212	0.461	5.810E-13	459	0.078	0.179	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1105	1130	0.514	0.480	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1841	965	0.847	0.926	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1139	983	0.521	0.560	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1504	1055	0.655	0.655	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1952	946	0.885	0.987	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	2048	986	0.923	0.988	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1096	918	0.502	0.577	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	734	1005	0.389	0.408	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	716	977	0.384	0.415	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1151	949	0.536	0.596	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	2047	987	0.925	0.989	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	942	1014	0.451	0.469	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	1127	984	0.515	0.552	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	1035	1004	0.470	0.494	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	923	1021	0.445	0.460	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	1073	987	0.518	0.553	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	1040	976	0.502	0.543	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	732	1019	0.398	0.412	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	1564	984	0.681	0.730	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	736	976	0.391	0.423	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	15	16.2	ABC1 atypical kinase-like domain
2	PF12662 cEGF	1.6e+02	13.6	Complement Clr-like EGF-like
3	PF14575 EphA2_TM	1.1e-23	95.1	Ephrin type-A receptor 2 transmembrane domain
4	PF01404 Ephrin_lbd	1.8e-69	244.9	Ephrin receptor ligand binding domain
5	PF07699 Ephrin_rec_like	0.0021	29.1	Tyrosine-protein kinase ephrin type A/B receptor-like
6	PF00041 fn3	5.3e-32	121.3	Fibronectin type III domain
7	PF16893 fn3_2	2.7e+02	13.1	Fibronectin type III domain
8	PF12330 Haspin_kinase	6.3e+02	10.7	Haspin like kinase domain
9	PF09294 Interfer-bind	3.6e+02	12.9	Interferon-alpha/beta receptor, fibronectin type III
10	PF06293 Kdo	2.7e+02	12.3	Lipopolysaccharide kinase (Kdo/WaaP) family
11	PF00069 Pkinase	1.6e-44	163.9	Protein kinase domain
12	PF07714 PK_Tyr_Ser-Thr	4.4e-95	329.4	Protein tyrosine and serine/threonine kinase
13	PF16656 Pur_ac_phosph_N	2.4	20.2	Purple acid Phosphatase, N-terminal domain
14	PF00536 SAM_1	2.6e-17	74.3	SAM domain (Sterile alpha motif)
15	PF07647 SAM_2	2e-15	68.0	SAM domain (Sterile alpha motif)
16	PF14292 SusE	42	15.9	SusE outer membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000052704

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010233	0.998	Ephrin-B2
2	9598.ENSPTRP00000029298	0.994	ephrin-A5
3	9598.ENSPTRP00000037780	0.989	ephrin-B1
4	9598.ENSPTRP00000029205	0.950	RAS p21 protein activator (GTPase activating protein) 1
5	9598.ENSPTRP00000053140	0.928	Uncharacterized protein
6	9598.ENSPTRP00000013475	0.901	Polo-like kinase 1
7	9598.ENSPTRP00000023836	0.901	T-cell lymphoma invasion and metastasis 1
8	9598.ENSPTRP00000022308	0.894	Uncharacterized protein
9	9598.ENSPTRP00000034956	0.874	Belongs to the syndecan proteoglycan family.
10	9598.ENSPTRP00000053973	0.865	Intersectin 1 (SH3 domain protein)
11	9598.ENSPTRP00000002368	0.848	Uncharacterized protein
12	9598.ENSPTRP00000028167	0.833	MAD2 mitotic arrest deficient-like 1
13	9598.ENSPTRP00000036748	0.829	C-abl oncogene 1, non-receptor tyrosine kinase
14	9598.ENSPTRP00000023137	0.822	Tyrosine-protein kinase
15	9598.ENSPTRP00000049164	0.817	ephrin-A2
16	9598.ENSPTRP00000045621	0.813	NUMB, endocytic adaptor protein
17	9598.ENSPTRP00000002366	0.812	Uncharacterized protein
18	9598.ENSPTRP00000051373	0.806	Probable role in mitotic spindle regulation and coordination of mitotic processes. May have a preferential role in regulating neurogenesis (By similarity)
19	9598.ENSPTRP00000058895	0.796	Dynamin 1
20	9598.ENSPTRP00000001089	0.792	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0005003	0.993	ephrin receptor activity
GO:0001540	0.951	amyloid-beta binding
GO:0005005	0.518	transmembrane-ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0048013	0.973	ephrin receptor signaling pathway
GO:0032501	0.968	multicellular organismal process
GO:0048518	0.965	positive regulation of biological process
GO:0051239	0.941	regulation of multicellular organismal process
GO:0044087	0.940	regulation of cellular component biogenesis
GO:0050803	0.928	regulation of synapse structure or activity
GO:0034330	0.926	cell junction organization
GO:0032502	0.916	developmental process
GO:0048519	0.916	negative regulation of biological process
GO:0048856	0.913	anatomical structure development
GO:0007399	0.902	nervous system development
GO:1901888	0.901	regulation of cell junction assembly
GO:0007417	0.882	central nervous system development
GO:0048583	0.867	regulation of response to stimulus
GO:1902531	0.859	regulation of intracellular signal transduction
GO:0048522	0.858	positive regulation of cellular process
GO:0051130	0.841	positive regulation of cellular component organization
GO:0019222	0.824	regulation of metabolic process
GO:0008152	0.811	metabolic process
GO:0030154	0.810	cell differentiation
GO:0050793	0.803	regulation of developmental process
GO:0071704	0.801	organic substance metabolic process
GO:0060322	0.799	head development
GO:0048513	0.794	animal organ development
GO:0099173	0.788	postsynapse organization
GO:0060255	0.785	regulation of macromolecule metabolic process
GO:0050807	0.782	regulation of synapse organization
GO:0044238	0.777	primary metabolic process
GO:2000026	0.768	regulation of multicellular organismal development
GO:0016310	0.766	phosphorylation
GO:1904646	0.739	cellular response to amyloid-beta
GO:0006807	0.721	nitrogen compound metabolic process
GO:0048523	0.717	negative regulation of cellular process
GO:0048468	0.711	cell development
GO:0016477	0.707	cell migration
GO:0065009	0.706	regulation of molecular function
GO:0045595	0.702	regulation of cell differentiation
GO:0043170	0.699	macromolecule metabolic process
GO:0022603	0.695	regulation of anatomical structure morphogenesis
GO:0051965	0.695	positive regulation of synapse assembly
GO:0099175	0.694	regulation of postsynapse organization
GO:0060996	0.667	dendritic spine development
GO:0010468	0.658	regulation of gene expression
GO:0120035	0.650	regulation of plasma membrane bounded cell projection organization
GO:1901564	0.631	organonitrogen compound metabolic process
GO:0032879	0.621	regulation of localization
GO:0080134	0.608	regulation of response to stress
GO:0009653	0.607	anatomical structure morphogenesis
GO:0019538	0.605	protein metabolic process
GO:0002682	0.586	regulation of immune system process
GO:0036211	0.573	protein modification process
GO:0010975	0.569	regulation of neuron projection development
GO:0009605	0.554	response to external stimulus
GO:0000904	0.548	cell morphogenesis involved in differentiation
GO:0051241	0.540	negative regulation of multicellular organismal process
GO:0007420	0.506	brain development
GO:0051171	0.505	regulation of nitrogen compound metabolic process
GO:0050767	0.482	regulation of neurogenesis
GO:0009893	0.473	positive regulation of metabolic process
GO:0080090	0.461	regulation of primary metabolic process
GO:0031323	0.448	regulation of cellular metabolic process
GO:0010604	0.443	positive regulation of macromolecule metabolic process
GO:0009892	0.405	negative regulation of metabolic process
GO:0032101	0.390	regulation of response to external stimulus
GO:0006468	0.362	protein phosphorylation
GO:0051246	0.314	regulation of protein metabolic process
GO:0050790	0.313	regulation of catalytic activity
GO:0021535	0.306	cell migration in hindbrain

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.977	intracellular anatomical structure
GO:0012505	0.973	endomembrane system
GO:0005737	0.973	cytoplasm
GO:0043226	0.964	organelle
GO:0043227	0.914	membrane-bounded organelle
GO:0043229	0.885	intracellular organelle
GO:0043231	0.879	intracellular membrane-bounded organelle
GO:0005829	0.801	cytosol
GO:0030054	0.729	cell junction
GO:0005634	0.725	nucleus
GO:0031974	0.658	membrane-enclosed lumen
GO:0070013	0.648	intracellular organelle lumen
GO:0045202	0.644	synapse
GO:0031981	0.461	nuclear lumen
GO:0005654	0.450	nucleoplasm
GO:0005576	0.445	extracellular region
GO:0098978	0.375	glutamatergic synapse
GO:0120025	0.338	plasma membrane bounded cell projection
GO:0043005	0.323	neuron projection
GO:0036477	0.314	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]