StarFunc result for job id P29350

User Input

>input (595 residues)
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81718	0.909	0.883	0.000	613	0.934	0.907	P81718.pdb.gz	PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus OX=10116 GN=Ptpn6 PE=1 SV=1
2	PDB:3ps5A	0.880	0.989	5.170E-100	529	0.887	0.998	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
3	AFDB:A0A2R8Q2T0	0.875	0.883	1.571E-91	590	0.645	0.651	A0A2R8Q2T0.pdb.gz	A0A2R8Q2T0_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=Hcph PE=3 SV=1
4	AFDB:F1R1Z7	0.876	0.880	4.760E-85	592	0.592	0.595	F1R1Z7.pdb.gz
5	AFDB:A0A2R8QL35	0.564	0.560	1.102E-76	599	0.541	0.538	A0A2R8QL35.pdb.gz
6	PDB:5xzrA	0.519	0.592	9.880E-69	519	0.519	0.595	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
7	PDB:4gwfA	0.512	0.610	4.520E-68	497	0.513	0.614	4gwfA.pdb.gz
8	AFDB:P29349	0.530	0.378	2.750E-65	845	0.476	0.335	P29349.pdb.gz	CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster OX=7227 GN=csw PE=1 SV=2
9	AFDB:G5EC24	0.770	0.690	1.018E-53	668	0.375	0.334	G5EC24.pdb.gz	PTP2_CAEEL Tyrosine-protein phosphatase non-receptor type ptp-2 OS=Caenorhabditis elegans OX=6239 GN=ptp-2 PE=1 SV=1
10	AFDB:B6HY54	0.463	0.173	2.189E-30	1650	0.227	0.082	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
11	AFDB:A0A0R4ITJ9	0.450	0.148	2.592E-30	1892	0.208	0.066	A0A0R4ITJ9.pdb.gz	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
12	AFDB:A0A286Y939	0.468	0.359	3.435E-30	780	0.180	0.137	A0A286Y939.pdb.gz
13	AFDB:Q16K62	0.456	0.295	3.435E-30	936	0.210	0.134	Q16K62.pdb.gz	Q16K62_AEDAE protein-tyrosine-phosphatase OS=Aedes aegypti OX=7159 GN=AAEL013105 PE=1 SV=1
14	PDB:6krwA	0.432	0.817	2.428E-24	306	0.175	0.340	6krwA.pdb.gz
15	PDB:3m4uA	0.392	0.785	2.669E-18	285	0.129	0.270	3m4uA.pdb.gz
16	PDB:4fl2A	0.153	0.164	3.123E-11	555	0.092	0.099	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:4k2rA	0.154	0.166	3.518E-10	551	0.101	0.109	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
18	PDB:1k9aB	0.152	0.203	4.751E-7	441	0.072	0.098	1k9aB.pdb.gz
19	PDB:2h8hA	0.165	0.217	6.337E-6	445	0.062	0.083	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:1griA	0.148	0.385	6.704E-6	211	0.074	0.209	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q2T0	0.0	780	590	0.637	0.642	A0A2R8Q2T0_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=Hcph PE=3 SV=1
2	E7F3D4	0.0	784	589	0.640	0.647	E7F3D4_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=Hcph PE=2 SV=2
3	F1N339	0.0	652	593	0.534	0.536	F1N339_BOVIN Tyrosine-protein phosphatase non-receptor type OS=Bos taurus OX=9913 GN=PTPN11 PE=3 SV=3
4	P29350	0.0	1246	595	1.000	1.000	PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1
5	P29351	0.0	1169	595	0.945	0.945	PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus OX=10090 GN=Ptpn6 PE=1 SV=2
6	P35235	0.0	654	593	0.536	0.538	PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 OS=Mus musculus OX=10090 GN=Ptpn11 PE=1 SV=3
7	P41499	0.0	655	593	0.536	0.538	PTN11_RAT Tyrosine-protein phosphatase non-receptor type 11 OS=Rattus norvegicus OX=10116 GN=Ptpn11 PE=1 SV=5
8	P81718	0.0	1159	613	0.934	0.907	PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus OX=10116 GN=Ptpn6 PE=1 SV=1
9	Q06124	0.0	654	593	0.538	0.540	PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3
10	Q53XS4	0.0	1240	597	0.995	0.992	Q53XS4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN6 PE=2 SV=1
11	Q7SY37	0.0	702	592	0.590	0.593	Q7SY37_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=zgc:63553 PE=2 SV=1
12	Q7ZW17	0.0	652	594	0.539	0.540	Q7ZW17_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn11 PE=1 SV=1
13	Q803M6	0.0	783	589	0.637	0.643	Q803M6_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=fj22f05 PE=2 SV=1
14	S6CMQ2	0.0	706	590	0.593	0.598	S6CMQ2_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=shp3 PE=2 SV=1
15	G5EC24	2.79e-103	328	668	0.366	0.326	PTP2_CAEEL Tyrosine-protein phosphatase non-receptor type ptp-2 OS=Caenorhabditis elegans OX=6239 GN=ptp-2 PE=1 SV=1
16	P29349	6.55e-97	316	845	0.264	0.186	CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster OX=7227 GN=csw PE=1 SV=2
17	A5HV10	9.48e-59	211	709	0.210	0.176	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
18	A5I9F0	8.81e-57	209	1439	0.210	0.087	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
19	Q15262	1.09e-56	209	1439	0.210	0.087	PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=2
20	E9PGC5	1.80e-56	208	1472	0.212	0.086	E9PGC5_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.15	23.4	Dual specificity phosphatase, catalytic domain
2	PF15666 HGAL	9.4e+02	11.3	Germinal center-associated lymphoma
3	PF14566 PTPlike_phytase	31	16.1	Inositol hexakisphosphate
4	PF00017 SH2	1.3e-42	155.1	SH2 domain
5	PF00102 Y_phosphatase	7.9e-74	259.7	Protein-tyrosine phosphatase
6	PF13350 Y_phosphatase3	7.9	18.0	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000004802

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000021551	0.967	Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO)
2	9601.ENSPPYP00000017943	0.960	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
3	9601.ENSPPYP00000001481	0.947	Janus kinase 1
4	9601.ENSPPYP00000000644	0.945	CD247 molecule
5	9601.ENSPPYP00000011038	0.944	CD22 molecule
6	9601.ENSPPYP00000014639	0.937	Cytotoxic T-lymphocyte-associated protein 4
7	9601.ENSPPYP00000009599	0.932	Platelet/endothelial cell adhesion molecule 1
8	9601.ENSPPYP00000005677	0.920	Protein tyrosine phosphatase, non-receptor type 11
9	9601.ENSPPYP00000011649	0.903	Uncharacterized protein
10	9601.ENSPPYP00000010613	0.902	Vav 1 guanine nucleotide exchange factor
11	9601.ENSPPYP00000011626	0.902	Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
12	9601.ENSPPYP00000011635	0.902	annotation not available
13	9601.ENSPPYP00000011828	0.902	Uncharacterized protein
14	9601.ENSPPYP00000023741	0.902	Uncharacterized protein
15	9601.ENSPPYP00000004879	0.900	Killer cell lectin-like receptor subfamily C, member 1
16	9601.ENSPPYP00000023007	0.899	Bruton agammaglobulinemia tyrosine kinase
17	9601.ENSPPYP00000008163	0.898	Linker for activation of T cells
18	9601.ENSPPYP00000001627	0.891	Uncharacterized protein
19	9601.ENSPPYP00000008184	0.891	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
20	9601.ENSPPYP00000017341	0.891	Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Plays an important role in signaling in response to FGFR1, FGFR2, FGFR3, FGFR4, KITLG/SCF, KIT, PDGFRA and PDGFRB. Likewise, plays a role in ITGB2 signaling. Modulates the cellular response to ER stress by promoting nuclear translocation of XBP1 in a ER stress- and/or insulin-dependent manner [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0045309	0.962	protein phosphorylated amino acid binding
GO:0001784	0.953	phosphotyrosine residue binding
GO:0005102	0.917	signaling receptor binding
GO:0019899	0.910	enzyme binding
GO:0019901	0.901	protein kinase binding
GO:0038023	0.558	signaling receptor activity
GO:1990782	0.487	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.995	cellular response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.992	signaling
GO:0071704	0.990	organic substance metabolic process
GO:0002682	0.988	regulation of immune system process
GO:0044237	0.986	cellular metabolic process
GO:0042221	0.984	response to chemical
GO:0007165	0.982	signal transduction
GO:0019222	0.981	regulation of metabolic process
GO:0048583	0.976	regulation of response to stimulus
GO:0050865	0.976	regulation of cell activation
GO:0006793	0.975	phosphorus metabolic process
GO:0036211	0.975	protein modification process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0034097	0.972	response to cytokine
GO:0030155	0.964	regulation of cell adhesion
GO:0050730	0.963	regulation of peptidyl-tyrosine phosphorylation
GO:0002376	0.961	immune system process
GO:0002694	0.958	regulation of leukocyte activation
GO:0018212	0.956	peptidyl-tyrosine modification
GO:0032502	0.954	developmental process
GO:0071345	0.947	cellular response to cytokine stimulus
GO:0006950	0.945	response to stress
GO:0048518	0.943	positive regulation of biological process
GO:0016311	0.926	dephosphorylation
GO:0048519	0.925	negative regulation of biological process
GO:0010646	0.924	regulation of cell communication
GO:0048523	0.914	negative regulation of cellular process
GO:0023051	0.913	regulation of signaling
GO:0018108	0.912	peptidyl-tyrosine phosphorylation
GO:0032501	0.910	multicellular organismal process
GO:1903037	0.907	regulation of leukocyte cell-cell adhesion
GO:0048584	0.896	positive regulation of response to stimulus
GO:0048856	0.883	anatomical structure development
GO:0035556	0.871	intracellular signal transduction
GO:0019221	0.867	cytokine-mediated signaling pathway
GO:0048522	0.832	positive regulation of cellular process
GO:0006955	0.816	immune response
GO:0045785	0.816	positive regulation of cell adhesion
GO:0007275	0.807	multicellular organism development
GO:0050776	0.787	regulation of immune response
GO:0009966	0.780	regulation of signal transduction
GO:0009611	0.777	response to wounding
GO:0051249	0.777	regulation of lymphocyte activation
GO:0050863	0.767	regulation of T cell activation
GO:0002684	0.758	positive regulation of immune system process
GO:0050867	0.758	positive regulation of cell activation
GO:0043408	0.756	regulation of MAPK cascade
GO:0002696	0.751	positive regulation of leukocyte activation
GO:0006470	0.747	protein dephosphorylation
GO:0009968	0.722	negative regulation of signal transduction
GO:0065009	0.710	regulation of molecular function
GO:0050790	0.679	regulation of catalytic activity
GO:0022409	0.679	positive regulation of cell-cell adhesion
GO:0009892	0.654	negative regulation of metabolic process
GO:0031400	0.617	negative regulation of protein modification process
GO:0042326	0.615	negative regulation of phosphorylation
GO:0050778	0.600	positive regulation of immune response
GO:0050732	0.600	negative regulation of peptidyl-tyrosine phosphorylation
GO:0001775	0.586	cell activation
GO:0048731	0.575	system development
GO:0080134	0.569	regulation of response to stress
GO:0043549	0.554	regulation of kinase activity
GO:0010468	0.466	regulation of gene expression
GO:0009605	0.461	response to external stimulus
GO:0044419	0.443	biological process involved in interspecies interaction between organisms
GO:0050793	0.438	regulation of developmental process
GO:0065008	0.422	regulation of biological quality
GO:0048513	0.417	animal organ development
GO:0023056	0.416	positive regulation of signaling
GO:0010647	0.416	positive regulation of cell communication
GO:0030154	0.415	cell differentiation
GO:0009893	0.410	positive regulation of metabolic process
GO:0032879	0.404	regulation of localization
GO:0009967	0.397	positive regulation of signal transduction
GO:0010604	0.395	positive regulation of macromolecule metabolic process
GO:0045321	0.368	leukocyte activation
GO:0051173	0.340	positive regulation of nitrogen compound metabolic process
GO:0042127	0.335	regulation of cell population proliferation
GO:0006952	0.330	defense response
GO:0051251	0.328	positive regulation of lymphocyte activation
GO:0007167	0.322	enzyme-linked receptor protein signaling pathway
GO:0031325	0.316	positive regulation of cellular metabolic process
GO:2000026	0.314	regulation of multicellular organismal development
GO:1903039	0.312	positive regulation of leukocyte cell-cell adhesion
GO:0007169	0.306	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042327	0.304	positive regulation of phosphorylation
GO:0050870	0.302	positive regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.975	intracellular organelle
GO:0005829	0.948	cytosol
GO:0043227	0.942	membrane-bounded organelle
GO:0043231	0.904	intracellular membrane-bounded organelle
GO:0016020	0.903	membrane
GO:0005634	0.889	nucleus
GO:0070013	0.811	intracellular organelle lumen
GO:0031981	0.791	nuclear lumen
GO:0005886	0.786	plasma membrane
GO:0005654	0.781	nucleoplasm
GO:0032991	0.775	protein-containing complex
GO:0043228	0.660	non-membrane-bounded organelle
GO:0043232	0.634	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]