StarFunc result for job id P29353

User Input

>input (583 residues)
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29353	0.999	0.999	3.340E-99	583	1.000	1.000	P29353.pdb.gz	SHC1_HUMAN SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1 PE=1 SV=4
2	AFDB:Q24080	0.280	0.393	6.501E-37	409	0.300	0.428	Q24080.pdb.gz	Q24080_DROME DShc OS=Drosophila melanogaster OX=7227 GN=Shc PE=2 SV=1
3	AFDB:A1L1I3	0.228	0.217	4.261E-10	614	0.117	0.111	A1L1I3.pdb.gz	NUMBL_RAT Numb-like protein OS=Rattus norvegicus OX=10116 GN=Numbl PE=1 SV=1
4	AFDB:A0A2R8QR19	0.163	0.112	7.975E-9	862	0.098	0.066	A0A2R8QR19.pdb.gz
5	AFDB:Q9W2S5	0.228	0.066	2.231E-7	2139	0.122	0.033	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
6	AFDB:X2JE74	0.216	0.110	1.573E-6	1170	0.101	0.050	X2JE74.pdb.gz	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
7	PDB:5xzrA	0.145	0.161	1.429E-5	519	0.065	0.073	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
8	PDB:3ps5A	0.153	0.168	2.847E-5	529	0.051	0.057	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
9	PDB:1k9aB	0.147	0.193	4.018E-5	441	0.053	0.070	1k9aB.pdb.gz
10	PDB:4fl2A	0.147	0.154	4.255E-5	555	0.053	0.056	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
11	PDB:1griA	0.134	0.352	4.773E-5	211	0.046	0.128	1griA.pdb.gz
12	AFDB:Q9HBL0	0.125	0.044	4.937E-5	1735	0.184	0.062	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
13	PDB:8dcxB	0.159	0.371	5.056E-5	236	0.050	0.123	8dcxB.pdb.gz
14	PDB:4gwfA	0.150	0.175	5.355E-5	497	0.060	0.070	4gwfA.pdb.gz
15	PDB:1ka6A	0.142	0.687	6.361E-5	107	0.055	0.299	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
16	AFDB:M9PHY7	0.167	0.098	6.579E-5	1021	0.139	0.079	M9PHY7.pdb.gz	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
17	PDB:4k2rA	0.146	0.154	1.067E-4	551	0.051	0.054	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
18	AFDB:Q8N5H7	0.154	0.106	1.238E-4	860	0.113	0.077	Q8N5H7.pdb.gz	SH2D3_HUMAN SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C PE=1 SV=1
19	AFDB:E9Q0S6	0.125	0.041	2.075E-4	1888	0.161	0.050	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
20	PDB:2lqnA	0.131	0.239	3.564E-4	303	0.046	0.089	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F3T0	0.0	679	454	0.609	0.782	E7F3T0_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=2
2	E9QCZ8	0.0	677	449	0.607	0.788	E9QCZ8_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=1
3	P29353	0.0	1187	583	1.000	1.000	SHC1_HUMAN SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1 PE=1 SV=4
4	P98083	0.0	1099	579	0.945	0.952	SHC1_MOUSE SHC-transforming protein 1 OS=Mus musculus OX=10090 GN=Shc1 PE=1 SV=3
5	Q0IIE2	0.0	946	473	0.784	0.966	SHC1_BOVIN SHC-transforming protein 1 OS=Bos taurus OX=9913 GN=SHC1 PE=2 SV=1
6	Q5M824	0.0	924	469	0.768	0.955	SHC1_RAT SHC-transforming protein 1 OS=Rattus norvegicus OX=10116 GN=Shc1 PE=1 SV=1
7	O70143	1.99e-173	506	594	0.533	0.524	SHC3_RAT SHC-transforming protein 3 OS=Rattus norvegicus OX=10116 GN=Shc3 PE=2 SV=1
8	Q61120	9.71e-170	492	474	0.456	0.561	SHC3_MOUSE SHC-transforming protein 3 OS=Mus musculus OX=10090 GN=Shc3 PE=1 SV=2
9	Q92529	3.91e-167	490	594	0.518	0.508	SHC3_HUMAN SHC-transforming protein 3 OS=Homo sapiens OX=9606 GN=SHC3 PE=1 SV=1
10	P98077	9.30e-162	476	582	0.484	0.485	SHC2_HUMAN SHC-transforming protein 2 OS=Homo sapiens OX=9606 GN=SHC2 PE=1 SV=4
11	Q6S5L8	1.56e-161	477	630	0.515	0.476	SHC4_HUMAN SHC-transforming protein 4 OS=Homo sapiens OX=9606 GN=SHC4 PE=1 SV=1
12	Q6S5L9	1.75e-142	428	626	0.422	0.393	SHC4_MOUSE SHC-transforming protein 4 OS=Mus musculus OX=10090 GN=Shc4 PE=1 SV=1
13	Q9Z1I0	1.18e-94	287	138	0.237	1.000	Q9Z1I0_RAT Shc transforming protein (Fragment) OS=Rattus norvegicus OX=10116 GN=shc PE=2 SV=1
14	Q9V3C8	5.10e-84	270	409	0.312	0.445	Q9V3C8_DROME DShc protein OS=Drosophila melanogaster OX=7227 GN=Shc PE=1 SV=1
15	Q24080	7.96e-83	266	409	0.310	0.443	Q24080_DROME DShc OS=Drosophila melanogaster OX=7227 GN=Shc PE=2 SV=1
16	Q9TYT3	6.48e-22	99.0	316	0.103	0.190	SHCH1_CAEEL SHC-transforming protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=shc-1 PE=1 SV=2
17	P09760	1.00e-10	67.0	823	0.074	0.052	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
18	P70451	1.39e-10	66.6	823	0.058	0.041	FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus OX=10090 GN=Fer PE=1 SV=2
19	P16591	1.41e-10	66.6	822	0.062	0.044	FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2
20	W0S0X4	1.41e-10	66.6	822	0.062	0.044	W0S0X4_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=Pe1Fe3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05372 Delta_lysin	3.2e+02	12.0	Delta lysin family
2	PF00640 PID	1.5e-43	159.6	Phosphotyrosine interaction domain (PTB/PID)
3	PF00017 SH2	5.7e-14	63.3	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263923	0.999	Vascular endothelial growth factor receptor 2
2	9606.ENSP00000267101	0.999	Receptor tyrosine-protein kinase erbB-3
3	9606.ENSP00000268035	0.999	Insulin-like growth factor 1 receptor
4	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
5	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
6	9606.ENSP00000277120	0.999	BDNF/NT-3 growth factors receptor
7	9606.ENSP00000342235	0.999	Receptor tyrosine-protein kinase erbB-4
8	9606.ENSP00000347942	0.999	Proto-oncogene tyrosine-protein kinase receptor Ret
9	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
10	9606.ENSP00000387784	0.999	Son of sevenless homolog 1
11	9606.ENSP00000405338	0.999	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
12	9606.ENSP00000431418	0.999	High affinity nerve growth factor receptor
13	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
14	9606.ENSP00000264972	0.998	Tyrosine-protein kinase ZAP-70
15	9606.ENSP00000298229	0.998	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
16	9606.ENSP00000339186	0.998	GRB2-related adapter protein 2
17	9606.ENSP00000354952	0.998	GRB2-associated-binding protein 2
18	9606.ENSP00000405330	0.998	Estrogen receptor
19	9606.ENSP00000248594	0.997	Tyrosine-protein phosphatase non-receptor type 12
20	9606.ENSP00000262995	0.997	GRB2-associated-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.997	signaling receptor binding
GO:0019900	0.988	kinase binding
GO:0019901	0.981	protein kinase binding
GO:0051219	0.958	phosphoprotein binding
GO:0001784	0.951	phosphotyrosine residue binding
GO:0035591	0.927	signaling adaptor activity
GO:1990782	0.921	protein tyrosine kinase binding
GO:0030971	0.830	receptor tyrosine kinase binding
GO:0044877	0.827	protein-containing complex binding
GO:0030159	0.763	signaling receptor complex adaptor activity
GO:0046875	0.747	ephrin receptor binding
GO:0008289	0.744	lipid binding
GO:0005068	0.741	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005543	0.702	phospholipid binding
GO:0005159	0.558	insulin-like growth factor receptor binding
GO:0005158	0.542	insulin receptor binding
GO:0005168	0.538	neurotrophin TRKA receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0023052	0.981	signaling
GO:0007154	0.978	cell communication
GO:0051716	0.977	cellular response to stimulus
GO:0048518	0.977	positive regulation of biological process
GO:0048522	0.971	positive regulation of cellular process
GO:0048583	0.931	regulation of response to stimulus
GO:0007169	0.918	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009966	0.886	regulation of signal transduction
GO:0048584	0.869	positive regulation of response to stimulus
GO:0042127	0.862	regulation of cell population proliferation
GO:1902531	0.858	regulation of intracellular signal transduction
GO:0009967	0.856	positive regulation of signal transduction
GO:0019222	0.803	regulation of metabolic process
GO:0060255	0.793	regulation of macromolecule metabolic process
GO:0080090	0.768	regulation of primary metabolic process
GO:0031323	0.759	regulation of cellular metabolic process
GO:1902533	0.757	positive regulation of intracellular signal transduction
GO:0051171	0.751	regulation of nitrogen compound metabolic process
GO:0048856	0.724	anatomical structure development
GO:0032501	0.717	multicellular organismal process
GO:0048519	0.688	negative regulation of biological process
GO:0043408	0.673	regulation of MAPK cascade
GO:0038127	0.671	ERBB signaling pathway
GO:0009893	0.664	positive regulation of metabolic process
GO:0048523	0.632	negative regulation of cellular process
GO:0007173	0.631	epidermal growth factor receptor signaling pathway
GO:0051246	0.609	regulation of protein metabolic process
GO:0051174	0.606	regulation of phosphorus metabolic process
GO:0010604	0.603	positive regulation of macromolecule metabolic process
GO:0031325	0.601	positive regulation of cellular metabolic process
GO:0065009	0.590	regulation of molecular function
GO:0051173	0.539	positive regulation of nitrogen compound metabolic process
GO:0008284	0.524	positive regulation of cell population proliferation
GO:0051239	0.522	regulation of multicellular organismal process
GO:0009719	0.512	response to endogenous stimulus
GO:0042325	0.499	regulation of phosphorylation
GO:0007275	0.496	multicellular organism development
GO:0031399	0.488	regulation of protein modification process
GO:0001932	0.471	regulation of protein phosphorylation
GO:0006950	0.469	response to stress
GO:0010468	0.464	regulation of gene expression
GO:0009889	0.445	regulation of biosynthetic process
GO:0071495	0.431	cellular response to endogenous stimulus
GO:0048731	0.405	system development
GO:0050790	0.400	regulation of catalytic activity
GO:0042221	0.365	response to chemical
GO:0010941	0.365	regulation of cell death
GO:0043410	0.341	positive regulation of MAPK cascade
GO:0070848	0.338	response to growth factor
GO:0071840	0.322	cellular component organization or biogenesis
GO:0071363	0.319	cellular response to growth factor stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.992	plasma membrane
GO:0043226	0.770	organelle
GO:0043229	0.718	intracellular organelle
GO:0043227	0.670	membrane-bounded organelle
GO:0043231	0.656	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]