StarFunc result for job id P29373

User Input

>input (138 residues)
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGEL
ILTMTADDVVCTRVYVRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51673	0.996	0.988	1.683E-22	139	0.942	0.935	P51673.pdb.gz	RABP2_RAT Cellular retinoic acid-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Crabp2 PE=2 SV=2
2	PDB:7ry5BBB	0.988	0.953	6.459E-22	143	0.993	0.958	7ry5BBB.pdb.gz	Development of an Enzyme-Inhibitor Reaction Using Cellular Retinoic Acid Binding Protein II for One-Pot Megamolecule Assembly.
3	AFDB:B0FLN8	0.988	0.995	2.242E-20	137	0.746	0.752	B0FLN8.pdb.gz	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1
4	AFDB:Q801Y4	0.990	0.962	6.146E-20	142	0.746	0.725	Q801Y4.pdb.gz	Q801Y4_DANRE Cellular retinoic acid binding protein type II OS=Danio rerio OX=7955 GN=zgc:110496 PE=1 SV=1
5	PDB:7a9yAAA	0.984	0.991	6.356E-20	137	0.754	0.759	7a9yAAA.pdb.gz	Structure-functional relationship of cellular retinoic acid-binding proteins I and II interacting with natural and synthetic ligands.
6	AFDB:A4VCG2	0.989	0.935	8.748E-20	146	0.696	0.658	A4VCG2.pdb.gz	A4VCG2_DANRE Cellular retinoic acid-binding protein 2 OS=Danio rerio OX=7955 GN=im:7136989 PE=1 SV=1
7	PDB:5ggeA	0.813	0.865	1.313E-12	129	0.413	0.442	5ggeA.pdb.gz
8	AFDB:O01814	0.854	0.865	2.102E-12	136	0.384	0.390	O01814.pdb.gz	FABP5_CAEEL Fatty acid-binding protein homolog 5 OS=Caenorhabditis elegans OX=6239 GN=lbp-5 PE=3 SV=1
9	AFDB:Q8UVG7	0.830	0.859	2.705E-12	133	0.399	0.414	Q8UVG7.pdb.gz	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
10	PDB:5hz9A	0.845	0.862	3.095E-12	135	0.413	0.422	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
11	PDB:4azqA	0.836	0.848	3.423E-12	136	0.341	0.346	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
12	PDB:6c1zA	0.855	0.855	3.423E-12	138	0.348	0.348	6c1zA.pdb.gz
13	PDB:7yf1A	0.847	0.877	3.423E-12	133	0.435	0.451	7yf1A.pdb.gz
14	AFDB:O15540	0.834	0.870	3.481E-12	132	0.399	0.417	O15540.pdb.gz	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
15	AFDB:P07483	0.836	0.866	3.481E-12	133	0.428	0.444	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
16	PDB:3nr3A	0.837	0.854	3.786E-12	135	0.384	0.393	3nr3A.pdb.gz
17	AFDB:O02324	0.859	0.864	4.050E-12	137	0.348	0.350	O02324.pdb.gz	FABP8_CAEEL Fatty acid-binding protein homolog 8 OS=Caenorhabditis elegans OX=6239 GN=lbp-8 PE=1 SV=2
18	AFDB:P02689	0.834	0.869	5.211E-12	132	0.384	0.402	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
19	PDB:5bvsA	0.843	0.878	5.389E-12	132	0.377	0.394	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
20	PDB:7e25A	0.829	0.823	1.038E-11	139	0.399	0.396	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29373	5.20e-99	281	138	1.000	1.000	RABP2_HUMAN Cellular retinoic acid-binding protein 2 OS=Homo sapiens OX=9606 GN=CRABP2 PE=1 SV=2
2	P22935	1.81e-94	270	138	0.935	0.935	RABP2_MOUSE Cellular retinoic acid-binding protein 2 OS=Mus musculus OX=10090 GN=Crabp2 PE=2 SV=2
3	P51673	9.95e-94	268	139	0.942	0.935	RABP2_RAT Cellular retinoic acid-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Crabp2 PE=2 SV=2
4	B0FLN8	2.62e-75	222	137	0.754	0.759	B0FLN8_CHICK Cellular retinoic acid binding protein I OS=Gallus gallus OX=9031 GN=CRABP-I PE=2 SV=1
5	P40220	2.62e-75	222	137	0.754	0.759	RABP1_CHICK Cellular retinoic acid-binding protein 1 OS=Gallus gallus OX=9031 GN=CRABP1 PE=2 SV=4
6	P29762	4.39e-75	221	137	0.768	0.774	RABP1_HUMAN Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2
7	P62964	1.47e-74	220	137	0.768	0.774	RABP1_BOVIN Cellular retinoic acid-binding protein 1 OS=Bos taurus OX=9913 GN=CRABP1 PE=1 SV=2
8	P62965	1.47e-74	220	137	0.768	0.774	RABP1_MOUSE Cellular retinoic acid-binding protein 1 OS=Mus musculus OX=10090 GN=Crabp1 PE=1 SV=2
9	P62966	1.47e-74	220	137	0.768	0.774	RABP1_RAT Cellular retinoic acid-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Crabp1 PE=1 SV=3
10	Q801Y4	6.17e-74	218	142	0.746	0.725	Q801Y4_DANRE Cellular retinoic acid binding protein type II OS=Danio rerio OX=7955 GN=zgc:110496 PE=1 SV=1
11	A4VCG2	1.02e-68	205	146	0.696	0.658	A4VCG2_DANRE Cellular retinoic acid-binding protein 2 OS=Danio rerio OX=7955 GN=im:7136989 PE=1 SV=1
12	Q5G9L7	1.20e-68	205	146	0.696	0.658	Q5G9L7_DANRE Cellular retinoic acid-binding protein 2 OS=Danio rerio OX=7955 GN=im:7136989 PE=1 SV=1
13	P11404	8.31e-30	106	133	0.449	0.466	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
14	P07483	1.31e-29	106	133	0.442	0.459	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
15	O15540	1.90e-28	103	132	0.413	0.432	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
16	P05413	1.93e-28	103	133	0.428	0.444	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
17	P51880	2.11e-28	103	132	0.406	0.424	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2
18	O01812	3.36e-28	102	135	0.442	0.452	FABP6_CAEEL Fatty acid-binding protein homolog 6 OS=Caenorhabditis elegans OX=6239 GN=lbp-6 PE=1 SV=1
19	Q05423	5.15e-28	102	132	0.413	0.432	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
20	Q00915	2.40e-27	100	135	0.442	0.452	RET1_MOUSE Retinol-binding protein 1 OS=Mus musculus OX=10090 GN=Rbp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	7.4e-22	89.6	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	0.0046	28.3	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482841

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231572	0.944	Arginine--tRNA ligase, cytoplasmic
2	9606.ENSP00000332296	0.912	Retinoic acid receptor beta
3	9606.ENSP00000385269	0.911	ELAV-like protein 1
4	9606.ENSP00000388510	0.872	Retinoic acid receptor gamma
5	9606.ENSP00000254066	0.860	Retinoic acid receptor alpha
6	9606.ENSP00000362082	0.844	G1/S-specific cyclin-D3
7	9606.ENSP00000419692	0.810	Retinoic acid receptor RXR-alpha
8	9606.ENSP00000224356	0.796	Cytochrome P450 26A1
9	9606.ENSP00000352900	0.744	Retinoic acid receptor RXR-gamma
10	9606.ENSP00000363817	0.743	Retinoic acid receptor RXR-beta
11	9606.ENSP00000255688	0.739	Retinoic acid receptor responder protein 3
12	9606.ENSP00000357688	0.739	Protein S100-A13
13	9606.ENSP00000378307	0.729	Protein polybromo-1
14	9606.ENSP00000408295	0.671	Replication factor C subunit 5
15	9606.ENSP00000001146	0.665	Cytochrome P450 26B1
16	9606.ENSP00000456609	0.655	Receptor for retinol uptake STRA6
17	9606.ENSP00000463151	0.645	Retinol-binding protein 3
18	9606.ENSP00000249750	0.634	Retinal dehydrogenase 2
19	9606.ENSP00000310928	0.608	Peroxisome proliferator-activated receptor delta
20	9606.ENSP00000245206	0.591	Aspartate aminotransferase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001972	0.999	retinoic acid binding
GO:0005515	0.988	protein binding
GO:0005504	0.778	fatty acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0050896	0.844	response to stimulus
GO:0071704	0.806	organic substance metabolic process
GO:0044238	0.722	primary metabolic process
GO:0032502	0.611	developmental process
GO:0044237	0.606	cellular metabolic process
GO:0048856	0.523	anatomical structure development
GO:0019222	0.449	regulation of metabolic process
GO:0060255	0.332	regulation of macromolecule metabolic process
GO:0051716	0.326	cellular response to stimulus
GO:0006629	0.322	lipid metabolic process
GO:0048518	0.307	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0031974	0.957	membrane-enclosed lumen
GO:0070013	0.953	intracellular organelle lumen
GO:0005634	0.952	nucleus
GO:0005654	0.835	nucleoplasm
GO:0005576	0.724	extracellular region
GO:0043230	0.570	extracellular organelle
GO:0005615	0.556	extracellular space
GO:1903561	0.550	extracellular vesicle
GO:0070062	0.480	extracellular exosome
GO:0012505	0.358	endomembrane system
GO:0016020	0.307	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]