StarFunc result for job id P29375

User Input

>input (1690 residues)
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ
IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVLM
SEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVI
SQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQSGSNYAYL
EQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEA
MHSLRAANLAKMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSA
FNRVVSSVSSSPRQTMDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKD
SSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNKLAKKLAKEEE
RKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPVSPGPAPPPSFIMSYK
LPMEDLKETS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0S6L0	0.427	0.456	0.000	1578	0.464	0.497	B0S6L0.pdb.gz	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
2	AFDB:P29375	1.000	1.000	0.000	1690	1.000	1.000	P29375.pdb.gz	KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A PE=1 SV=3
3	AFDB:Q62240	0.455	0.495	0.000	1548	0.460	0.502	Q62240.pdb.gz	KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus OX=10090 GN=Kdm5d PE=2 SV=2
4	AFDB:Q80Y84	0.463	0.505	0.000	1544	0.483	0.529	Q80Y84.pdb.gz	KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1
5	AFDB:Q23541	0.374	0.422	2.360E-86	1477	0.251	0.287	Q23541.pdb.gz	KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans OX=6239 GN=rbr-2 PE=1 SV=2
6	AFDB:Q9HDV4	0.322	0.354	1.369E-57	1513	0.183	0.204	Q9HDV4.pdb.gz	LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lid2 PE=1 SV=1
7	AFDB:F4I240	0.224	0.311	3.023E-49	1208	0.184	0.257	F4I240.pdb.gz	JMJ17_ARATH Lysine-specific demethylase JMJ17 OS=Arabidopsis thaliana OX=3702 GN=JMJ17 PE=1 SV=1
8	AFDB:Q9UT79	0.326	0.343	1.817E-48	1588	0.167	0.178	Q9UT79.pdb.gz	MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msc1 PE=3 SV=1
9	AFDB:Q9US53	0.303	0.677	6.569E-47	715	0.130	0.308	Q9US53.pdb.gz	JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj2 PE=4 SV=1
10	AFDB:P47156	0.291	0.630	1.122E-40	728	0.115	0.268	P47156.pdb.gz	JHD2_YEAST Histone demethylase JHD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JHD2 PE=1 SV=1
11	PDB:3al5B	0.067	0.306	2.615E-3	311	0.011	0.061	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:3al5C	0.068	0.321	6.116E-3	284	0.012	0.074	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:7cl4F	0.060	0.283	1.365E-2	285	0.016	0.095	7cl4F.pdb.gz
14	PDB:4qszA	0.054	0.124	1.500E-2	686	0.012	0.029	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
15	PDB:4b7eA	0.059	0.248	2.770E-2	349	0.011	0.052	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
16	PDB:7yxgA	0.072	0.327	3.044E-2	313	0.009	0.048	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
17	PDB:5nfnB	0.055	0.253	3.508E-2	318	0.012	0.063	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
18	PDB:7wooC	0.075	0.085	3.677E-2	1325	0.047	0.060	7wooC.pdb.gz
19	PDB:4cclB	0.058	0.214	4.881E-2	372	0.013	0.059	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:4nmiA	0.048	0.228	5.624E-2	280	0.012	0.071	4nmiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096MJZ8	3252	1635	0.928	0.960	A0A096MJZ8_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
2	A0A0G2JTU9	2998	1553	0.854	0.929	A0A0G2JTU9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=2
3	A0A0G2JW30	763	630	0.218	0.586	A0A0G2JW30_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=3 SV=2
4	A0A0G2K1H0	1521	1554	0.447	0.486	A0A0G2K1H0_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1
5	A0A0G2K3N6	1504	1544	0.431	0.472	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
6	A0A0G2K454	3255	1634	0.929	0.961	A0A0G2K454_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
7	A0A0G2K6G9	1506	1517	0.432	0.481	A0A0G2K6G9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
8	A0A0G2K897	1434	1510	0.429	0.480	A0A0G2K897_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=2
9	A0A384MR42	1469	1539	0.436	0.478	A0A384MR42_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=SMCY PE=2 SV=1
10	A0A3B3IS40	1502	1539	0.430	0.472	A0A3B3IS40_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
11	A0A3B3ISE6	1430	1472	0.413	0.474	A0A3B3ISE6_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
12	A0A3B3IT25	1516	1517	0.431	0.481	A0A3B3IT25_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
13	A0A3B3ITA8	1498	1499	0.428	0.483	A0A3B3ITA8_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
14	A0A3B3ITE7	1517	1505	0.432	0.485	A0A3B3ITE7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
15	A0A3B3ITJ7	1430	1503	0.412	0.464	A0A3B3ITJ7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
16	A0A8I5ZPK6	3254	1636	0.930	0.961	A0A8I5ZPK6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=3 SV=1
17	A6N6J7	1514	1440	0.444	0.522	A6N6J7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=JARID1C PE=2 SV=1
18	B0S6L0	1461	1578	0.438	0.470	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
19	B3KV94	1295	1275	0.375	0.497	B3KV94_HUMAN Jumonji, AT rich interactive domain 1B (RBP2-like), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
20	E9PFH2	1381	1476	0.415	0.476	E9PFH2_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase (Fragment) OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	1e-14	66.3	ARID/BRIGHT DNA binding domain
2	PF02373 JmjC	9.3e-43	156.7	JmjC domain, hydroxylase
3	PF02375 JmjN	4.2e-11	53.8	jmjN domain
4	PF00628 PHD	1.2e-22	90.8	PHD-finger
5	PF13831 PHD_2	19	16.1	PHD-finger
6	PF08429 PLU-1	1.1e-99	345.5	PLU-1-like protein
7	PF02928 zf-C5HC2	3.5e-10	51.4	C5HC2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369131	0.972	Paired amphipathic helix protein Sin3b
2	9606.ENSP00000329933	0.958	PHD finger protein 12
3	9606.ENSP00000331310	0.956	Mortality factor 4-like protein 1
4	9606.ENSP00000287957	0.951	GATA zinc finger domain-containing protein 1
5	9606.ENSP00000362649	0.943	Histone deacetylase 1
6	9606.ENSP00000267163	0.939	Retinoblastoma-associated protein
7	9606.ENSP00000308741	0.932	Circadian locomoter output cycles protein kaput
8	9606.ENSP00000345206	0.909	Recombining binding protein suppressor of hairless
9	9606.ENSP00000430432	0.908	Histone deacetylase 2
10	9606.ENSP00000362768	0.890	Retinoblastoma-like protein 1
11	9606.ENSP00000436786	0.875	Histone-lysine N-methyltransferase 2A
12	9606.ENSP00000433205	0.859	BRCA2-interacting transcriptional repressor EMSY
13	9606.ENSP00000320147	0.853	Histone-lysine N-methyltransferase EZH2
14	9606.ENSP00000383042	0.846	Lysine-specific histone demethylase 1A
15	9606.ENSP00000367203	0.829	Lysine-specific demethylase 6A
16	9606.ENSP00000316032	0.827	Nuclear pore complex protein Nup98-Nup96
17	9606.ENSP00000369424	0.823	Histone-binding protein RBBP7
18	9606.ENSP00000360493	0.812	Runt-related transcription factor 2
19	9606.ENSP00000340896	0.761	Set1/Ash2 histone methyltransferase complex subunit ASH2
20	9606.ENSP00000262519	0.752	Histone-lysine N-methyltransferase SETD1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0032453	0.999	histone H3K4 demethylase activity
GO:0140030	0.987	modification-dependent protein binding
GO:0042393	0.978	histone binding
GO:0008270	0.977	zinc ion binding
GO:0016706	0.969	2-oxoglutarate-dependent dioxygenase activity
GO:0043565	0.965	sequence-specific DNA binding
GO:0001067	0.909	transcription regulatory region nucleic acid binding
GO:0003690	0.907	double-stranded DNA binding
GO:0000976	0.904	transcription cis-regulatory region binding
GO:0140034	0.888	methylation-dependent protein binding
GO:0035064	0.871	methylated histone binding
GO:0034647	0.794	histone H3K4me/H3K4me2/H3K4me3 demethylase activity
GO:0008134	0.714	transcription factor binding
GO:0003712	0.514	transcription coregulator activity
GO:0003682	0.489	chromatin binding
GO:0140297	0.372	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0019538	0.979	protein metabolic process
GO:0036211	0.968	protein modification process
GO:0007548	0.958	sex differentiation
GO:0016570	0.956	histone modification
GO:0032501	0.952	multicellular organismal process
GO:0048856	0.941	anatomical structure development
GO:0046661	0.927	male sex differentiation
GO:0045137	0.920	development of primary sexual characteristics
GO:0061458	0.915	reproductive system development
GO:0008584	0.902	male gonad development
GO:0050789	0.867	regulation of biological process
GO:0050794	0.853	regulation of cellular process
GO:0019222	0.837	regulation of metabolic process
GO:0048232	0.824	male gamete generation
GO:0060255	0.812	regulation of macromolecule metabolic process
GO:0009987	0.810	cellular process
GO:0051171	0.795	regulation of nitrogen compound metabolic process
GO:0080090	0.794	regulation of primary metabolic process
GO:0031323	0.794	regulation of cellular metabolic process
GO:0007283	0.789	spermatogenesis
GO:0010468	0.766	regulation of gene expression
GO:0019219	0.749	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.713	regulation of DNA-templated transcription
GO:0048518	0.696	positive regulation of biological process
GO:0010604	0.568	positive regulation of macromolecule metabolic process
GO:0048522	0.539	positive regulation of cellular process
GO:0051173	0.434	positive regulation of nitrogen compound metabolic process
GO:0045935	0.416	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.407	negative regulation of biological process
GO:0048523	0.381	negative regulation of cellular process
GO:0050896	0.370	response to stimulus
GO:0010557	0.338	positive regulation of macromolecule biosynthetic process
GO:0031328	0.338	positive regulation of cellular biosynthetic process
GO:0051254	0.338	positive regulation of RNA metabolic process
GO:0045893	0.316	positive regulation of DNA-templated transcription
GO:0071840	0.312	cellular component organization or biogenesis
GO:0006357	0.312	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.967	protein-containing complex
GO:0005737	0.834	cytoplasm
GO:0043232	0.768	intracellular non-membrane-bounded organelle
GO:0005829	0.454	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.969	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:60208	0.794	3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate
EC:1.14.11.67	0.794	[histone H3]-trimethyl-L-lysine(4) demethylase.

[back to server]