StarFunc result for job id P29376

User Input

>input (864 residues)
MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLN
SPGTEGSWLFSTCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYL
ISAYGAAGGKGAKNHLSRAHGVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCL
GESRAVEEHAAMDGSEGVPGSRRWAGGGGGGGGATYVFRVRAGELEPLLVAAGGGGRAYL
RPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAPSPQAGRSLQEGAEGGQGC
SEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGVSFIHPSSELF
LQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTA
PNPYYCQVGLGPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQ
VAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKS
FLRHSRPHLGQPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCAGPSRVA
KIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLG
YMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASILERLQYC
TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL
SSGLKPLKSRGLQPQNLWNPTYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08923	0.713	0.697	0.000	888	0.791	0.769	P08923.pdb.gz	LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3
2	AFDB:P29376	1.000	1.000	0.000	864	1.000	1.000	P29376.pdb.gz	LTK_HUMAN Leukocyte tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=LTK PE=1 SV=3
3	AFDB:P97793	0.677	0.381	1.893E-100	1621	0.525	0.280	P97793.pdb.gz	ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Alk PE=1 SV=2
4	AFDB:F1QVU0	0.441	0.266	3.534E-99	1530	0.549	0.310	F1QVU0.pdb.gz	LTK_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ltk PE=1 SV=1
5	AFDB:Q9UM73	0.727	0.402	4.863E-99	1620	0.527	0.281	Q9UM73.pdb.gz	ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3
6	AFDB:Q7KJ08	0.345	0.178	1.833E-68	1701	0.366	0.186	Q7KJ08.pdb.gz	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
7	AFDB:A0A0R4IRF5	0.364	0.482	3.180E-47	651	0.291	0.386	A0A0R4IRF5.pdb.gz
8	AFDB:O76411	0.345	0.216	2.334E-44	1421	0.270	0.164	O76411.pdb.gz	SCD2_CAEEL ALK tyrosine kinase receptor homolog scd-2 OS=Caenorhabditis elegans OX=6239 GN=scd-2 PE=1 SV=3
9	AFDB:Q78DX7	0.312	0.119	2.493E-30	2340	0.185	0.068	Q78DX7.pdb.gz	ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
10	AFDB:F1QNX5	0.317	0.206	1.786E-29	1353	0.178	0.114	F1QNX5.pdb.gz
11	PDB:4fl2A	0.277	0.422	6.753E-20	555	0.113	0.177	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:1k9aB	0.271	0.520	7.512E-20	441	0.112	0.220	1k9aB.pdb.gz
13	PDB:2h8hA	0.279	0.517	1.090E-19	445	0.130	0.252	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4k2rA	0.270	0.416	3.116E-18	551	0.098	0.154	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.240	0.677	9.487E-14	283	0.089	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:5u6yA	0.248	0.451	2.223E-13	459	0.073	0.137	5u6yA.pdb.gz
17	PDB:6s73A	0.268	0.790	3.402E-13	269	0.074	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:2yaaA	0.273	0.727	5.793E-13	300	0.069	0.200	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
19	PDB:4rerA	0.248	0.448	9.863E-13	459	0.074	0.139	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:4krcA	0.256	0.692	1.040E-12	297	0.076	0.222	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LRZ0	0.0	768	1617	0.529	0.283	F1LRZ0_RAT Tyrosine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Alk PE=3 SV=4
2	F1QVU0	0.0	789	1530	0.542	0.306	LTK_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ltk PE=1 SV=1
3	F8W3R9	0.0	722	1705	0.487	0.247	ALK_DANRE ALK tyrosine kinase receptor OS=Danio rerio OX=7955 GN=alk PE=2 SV=2
4	P08923	0.0	1173	888	0.792	0.770	LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3
5	P29376	0.0	1731	864	1.000	1.000	LTK_HUMAN Leukocyte tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=LTK PE=1 SV=3
6	P97793	0.0	767	1621	0.527	0.281	ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Alk PE=1 SV=2
7	Q9UM73	0.0	775	1620	0.538	0.287	ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3
8	Q8CJH1	1.42e-150	448	351	0.263	0.647	Q8CJH1_RAT Tyrosine-protein kinase receptor (Fragment) OS=Rattus norvegicus OX=10116 GN=Alk PE=2 SV=1
9	Q8SWV4	2.13e-132	426	1158	0.350	0.261	Q8SWV4_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
10	Q7KJ08	4.68e-129	426	1701	0.350	0.178	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
11	Q78DX7	4.11e-81	289	2340	0.153	0.056	ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
12	P08922	3.06e-80	286	2347	0.163	0.060	ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3
13	Q05688	1.30e-77	266	640	0.148	0.200	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
14	Q64716	1.12e-75	271	1300	0.159	0.105	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
15	O73798	3.79e-75	270	1358	0.145	0.092	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
16	Q9WTL4	3.95e-75	270	1300	0.157	0.105	INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus OX=10090 GN=Insrr PE=1 SV=2
17	Q9PWN6	2.45e-74	265	989	0.145	0.126	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q60751	3.41e-74	267	1373	0.160	0.101	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
19	P14616	4.36e-74	266	1297	0.168	0.112	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
20	P24062	5.70e-74	266	1370	0.159	0.100	IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	3.6e+02	12.5	Complement Clr-like EGF-like
2	PF14670 FXa_inhibition	1.4e+02	14.3	Coagulation Factor Xa inhibitory site
3	PF12810 Gly_rich	1.5e-13	62.8	Glycine rich protein
4	PF00069 Pkinase	2.2e-27	107.7	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.6e-81	285.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351345	0.873	ALK and LTK ligand 1
2	9606.ENSP00000384604	0.799	ALK and LTK ligand 2
3	9606.ENSP00000428056	0.769	Phosphatidylinositol 3-kinase regulatory subunit alpha
4	9606.ENSP00000401303	0.761	SHC-transforming protein 1
5	9606.ENSP00000376345	0.661	Growth factor receptor-bound protein 2
6	9606.ENSP00000244007	0.611	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
7	9606.ENSP00000342681	0.556	T-cell surface glycoprotein CD5
8	9606.ENSP00000304895	0.544	Insulin receptor substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030295	0.999	protein kinase activator activity
GO:0004714	0.998	transmembrane receptor protein tyrosine kinase activity
GO:0030296	0.963	protein tyrosine kinase activator activity
GO:0019899	0.316	enzyme binding
GO:0005102	0.307	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.985	cellular response to stimulus
GO:0023052	0.979	signaling
GO:0048522	0.977	positive regulation of cellular process
GO:0007165	0.973	signal transduction
GO:0008152	0.956	metabolic process
GO:0044238	0.953	primary metabolic process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0043170	0.950	macromolecule metabolic process
GO:0019538	0.939	protein metabolic process
GO:0051128	0.899	regulation of cellular component organization
GO:0044237	0.890	cellular metabolic process
GO:0042981	0.854	regulation of apoptotic process
GO:0048519	0.848	negative regulation of biological process
GO:0006793	0.835	phosphorus metabolic process
GO:0046777	0.831	protein autophosphorylation
GO:0051130	0.804	positive regulation of cellular component organization
GO:0010975	0.789	regulation of neuron projection development
GO:0042221	0.778	response to chemical
GO:0035556	0.775	intracellular signal transduction
GO:0031346	0.769	positive regulation of cell projection organization
GO:0048523	0.765	negative regulation of cellular process
GO:0010976	0.764	positive regulation of neuron projection development
GO:0018212	0.673	peptidyl-tyrosine modification
GO:0048017	0.669	inositol lipid-mediated signaling
GO:0019222	0.648	regulation of metabolic process
GO:0048015	0.640	phosphatidylinositol-mediated signaling
GO:0014065	0.632	phosphatidylinositol 3-kinase signaling
GO:0048583	0.626	regulation of response to stimulus
GO:0071310	0.606	cellular response to organic substance
GO:0010660	0.594	regulation of muscle cell apoptotic process
GO:0048584	0.558	positive regulation of response to stimulus
GO:0018108	0.557	peptidyl-tyrosine phosphorylation
GO:0060548	0.519	negative regulation of cell death
GO:1901701	0.511	cellular response to oxygen-containing compound
GO:0043066	0.502	negative regulation of apoptotic process
GO:0031323	0.488	regulation of cellular metabolic process
GO:0009966	0.462	regulation of signal transduction
GO:0010665	0.455	regulation of cardiac muscle cell apoptotic process
GO:0060255	0.419	regulation of macromolecule metabolic process
GO:0023056	0.412	positive regulation of signaling
GO:0010647	0.412	positive regulation of cell communication
GO:0009967	0.394	positive regulation of signal transduction
GO:0009893	0.391	positive regulation of metabolic process
GO:0080090	0.368	regulation of primary metabolic process
GO:0007169	0.355	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0031325	0.330	positive regulation of cellular metabolic process
GO:1902531	0.324	regulation of intracellular signal transduction
GO:0051171	0.321	regulation of nitrogen compound metabolic process
GO:1902533	0.314	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.380	intracellular anatomical structure
GO:0043226	0.337	organelle
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.998	receptor protein-tyrosine kinase.

[back to server]