StarFunc result for job id P29400

User Input

>input (1685 residues)
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPG
PPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGALGPKGDRGFP
GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLL
GSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLI
GPPGLKGTIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPG
NPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGNPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMK
GDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGI
PGQPGLKGLPGPQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGP
PGPDGLQGPPGPPGTSSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPF
ISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQV
CMKRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63ZW6	0.159	0.158	0.000	1691	0.912	0.909	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
2	AFDB:B0UXF7	0.166	0.166	1.434E-90	1679	0.659	0.662	B0UXF7.pdb.gz
3	AFDB:F1MA59	0.151	0.152	3.730E-80	1669	0.613	0.619	F1MA59.pdb.gz	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
4	AFDB:Q9QZS0	0.152	0.154	1.719E-71	1669	0.563	0.568	Q9QZS0.pdb.gz	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
5	AFDB:F1LRJ1	0.151	0.152	1.767E-69	1671	0.560	0.565	F1LRJ1.pdb.gz	F1LRJ1_RAT Collagen type IV alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col4a3 PE=4 SV=2
6	AFDB:Q01955	0.151	0.153	1.040E-66	1670	0.544	0.549	Q01955.pdb.gz	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
7	AFDB:P17140	0.142	0.137	1.243E-59	1758	0.527	0.505	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
8	AFDB:Q14031	0.144	0.144	1.425E-57	1691	0.508	0.506	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
9	AFDB:P17139	0.138	0.132	7.311E-57	1759	0.507	0.486	P17139.pdb.gz	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
10	AFDB:B1AVK5	0.141	0.141	8.610E-57	1691	0.503	0.501	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
11	PDB:5iv5A	0.028	0.054	8.715E-2	658	0.008	0.020	5iv5A.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
12	PDB:7ajuCL	0.025	0.043	2.201E-1	808	0.009	0.020	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:3jc54	0.024	0.044	3.224E-1	569	0.009	0.028	3jc54.pdb.gz
14	PDB:6kxkD	0.031	0.065	3.595E-1	553	0.018	0.056	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
15	PDB:5k1bA	0.028	0.097	4.234E-1	264	0.009	0.057	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
16	PDB:6u3xB	0.040	0.096	4.471E-1	486	0.019	0.066	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
17	PDB:3ve1A	0.034	0.065	1.013	537	0.013	0.041	3ve1A.pdb.gz	The structural basis of transferrin sequestration by transferrin-binding protein B.
18	PDB:4mexA	0.020	0.073	1.069	298	0.006	0.034	4mexA.pdb.gz	Transcription inhibition by the depsipeptide antibiotic salinamide A.
19	PDB:6xtx4	0.021	0.042	1.069	598	0.012	0.033	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
20	PDB:6g2iA	0.026	0.023	1.259	2080	0.009	0.007	6g2iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AFK7	849	1562	0.548	0.591	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
2	B1AVK5	729	1691	0.403	0.402	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
3	F1KQQ4	738	1759	0.483	0.463	F1KQQ4_ASCSU Collagen alpha-1(IV) chain (Fragment) OS=Ascaris suum OX=6253 PE=2 SV=1
4	F1MA59	1102	1669	0.611	0.617	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
5	F1RLL9	660	1712	0.427	0.420	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
6	F7CK55	830	800	0.433	0.911	F7CK55_MOUSE Collagen, type IV, alpha 5 (Fragment) OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
7	O18407	688	1761	0.430	0.411	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
8	P02462	1033	1669	0.608	0.614	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
9	P02463	1121	1669	0.613	0.619	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
10	P08120	878	1779	0.477	0.452	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
11	P08122	759	1707	0.470	0.464	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
12	P08572	600	1712	0.299	0.294	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
13	P17139	907	1759	0.504	0.483	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
14	P17140	694	1758	0.367	0.352	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
15	P29400	2912	1685	1.000	1.000	CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens OX=9606 GN=COL4A5 PE=1 SV=2
16	Q14031	751	1691	0.480	0.478	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
17	Q3TP61	614	459	0.227	0.832	Q3TP61_MOUSE Collagen IV NC1 domain-containing protein OS=Mus musculus OX=10090 GN=Col4a5 PE=2 SV=1
18	Q63ZW6	1434	1691	0.909	0.906	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
19	Q80V57	649	585	0.284	0.819	Q80V57_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=2 SV=1
20	Q8BNS7	830	799	0.432	0.911	Q8BNS7_MOUSE Collagen IV NC1 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Col4a5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	4.1e-82	283.2	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	1.9e-194	641.0	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378340	0.963	Collagen alpha-6(IV) chain
2	9606.ENSP00000379350	0.940	Integrin beta-1
3	9606.ENSP00000452786	0.935	Integrin beta-3
4	9606.ENSP00000261023	0.932	Integrin alpha-V
5	9606.ENSP00000353654	0.925	Collagen alpha-2(IV) chain
6	9606.ENSP00000282588	0.921	Integrin alpha-1
7	9606.ENSP00000296585	0.921	Integrin alpha-2
8	9606.ENSP00000379866	0.918	Collagen alpha-4(IV) chain
9	9606.ENSP00000364979	0.917	Collagen alpha-1(IV) chain
10	9606.ENSP00000263556	0.915	Prolyl 4-hydroxylase subunit alpha-1
11	9606.ENSP00000379823	0.911	Collagen alpha-3(IV) chain
12	9606.ENSP00000384999	0.910	Prolyl 4-hydroxylase subunit alpha-2
13	9606.ENSP00000370542	0.905	Syndecan-1
14	9606.ENSP00000401749	0.905	Prolyl 4-hydroxylase subunit alpha-3
15	9606.ENSP00000253496	0.903	Coagulation factor XII
16	9606.ENSP00000354238	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
17	9606.ENSP00000226284	0.900	Bone sialoprotein 2
18	9606.ENSP00000351273	0.900	Caspase-8
19	9606.ENSP00000355361	0.900	Leukocyte surface antigen CD47
20	9606.ENSP00000363973	0.900	Alkaline phosphatase, tissue-nonspecific isozyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:0044877	0.333	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007154	0.991	cell communication
GO:0023052	0.989	signaling
GO:0007528	0.981	neuromuscular junction development
GO:0007165	0.975	signal transduction
GO:0007167	0.925	enzyme-linked receptor protein signaling pathway
GO:0007169	0.890	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032502	0.694	developmental process
GO:0032501	0.668	multicellular organismal process
GO:0048856	0.668	anatomical structure development
GO:0007275	0.435	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0012505	0.998	endomembrane system
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005581	0.974	collagen trimer
GO:0005604	0.973	basement membrane
GO:0099081	0.969	supramolecular polymer
GO:0098644	0.969	complex of collagen trimers
GO:0005587	0.964	collagen type IV trimer
GO:0030054	0.952	cell junction
GO:0005783	0.926	endoplasmic reticulum
GO:0005788	0.923	endoplasmic reticulum lumen
GO:0005615	0.833	extracellular space
GO:0016020	0.816	membrane
GO:0031594	0.671	neuromuscular junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]