StarFunc result for job id P29459

User Input

>input (219 residues)
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60595	0.921	0.802	4.380E-29	253	1.000	0.866	O60595.pdb.gz	O60595_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
2	AFDB:P54349	0.794	0.787	2.079E-23	221	0.826	0.819	P54349.pdb.gz	IL12A_BOVIN Interleukin-12 subunit alpha OS=Bos taurus OX=9913 GN=IL12A PE=2 SV=1
3	PDB:3hmxB	0.737	0.909	9.117E-19	176	0.790	0.983	3hmxB.pdb.gz
4	AFDB:P43431	0.758	0.771	1.699E-18	215	0.589	0.600	P43431.pdb.gz	IL12A_MOUSE Interleukin-12 subunit alpha OS=Mus musculus OX=10090 GN=Il12a PE=1 SV=1
5	AFDB:Q9R103	0.766	0.780	3.434E-18	215	0.580	0.591	Q9R103.pdb.gz	IL12A_RAT Interleukin-12 subunit alpha OS=Rattus norvegicus OX=10116 GN=Il12a PE=2 SV=1
6	AFDB:E7ENE1	0.574	0.584	1.552E-17	215	0.804	0.819	E7ENE1.pdb.gz	E7ENE1_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
7	PDB:1f45B	0.469	0.729	1.551E-10	133	0.607	1.000	1f45B.pdb.gz
8	AFDB:Q6F3R0	0.508	0.541	5.120E-3	204	0.178	0.191	Q6F3R0.pdb.gz
9	AFDB:P09919	0.494	0.519	5.953E-3	207	0.160	0.169	P09919.pdb.gz	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
10	AFDB:P26893	0.516	0.531	2.092E-2	212	0.128	0.132	P26893.pdb.gz	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
11	AFDB:P09920	0.463	0.484	2.200E-2	208	0.183	0.192	P09920.pdb.gz	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
12	PDB:4cniC	0.389	0.476	2.269E-2	171	0.114	0.146	4cniC.pdb.gz
13	AFDB:B8ZHI7	0.325	0.320	2.690E-2	224	0.174	0.170	B8ZHI7.pdb.gz	B8ZHI7_DANRE Colony-stimulating factor 3 (granulocyte) a OS=Danio rerio OX=7955 GN=gcsf PE=2 SV=1
14	PDB:5mj4B	0.496	0.646	3.752E-2	162	0.137	0.185	5mj4B.pdb.gz
15	PDB:3duhC	0.389	0.594	1.078E-1	137	0.142	0.226	3duhC.pdb.gz
16	PDB:4zs7A	0.436	0.653	1.386E-1	139	0.091	0.144	4zs7A.pdb.gz
17	PDB:3qwrB	0.418	0.621	1.612E-1	141	0.132	0.206	3qwrB.pdb.gz
18	PDB:1z7cA	0.331	0.414	1.874E-1	161	0.114	0.155	1z7cA.pdb.gz
19	PDB:1rhgB	0.445	0.652	2.665E-1	144	0.132	0.201	1rhgB.pdb.gz
20	PDB:6o4oA	0.343	0.412	3.099E-1	169	0.132	0.172	6o4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29459	1.38e-162	449	219	1.000	1.000	IL12A_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
2	O60595	4.80e-162	449	253	1.000	0.866	O60595_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
3	E9PGR3	7.09e-148	411	205	0.936	1.000	E9PGR3_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
4	E7ENE1	8.37e-117	332	181	0.826	1.000	E7ENE1_HUMAN Interleukin-12 subunit alpha OS=Homo sapiens OX=9606 GN=IL12A PE=1 SV=2
5	P54349	3.79e-116	332	221	0.817	0.810	IL12A_BOVIN Interleukin-12 subunit alpha OS=Bos taurus OX=9913 GN=IL12A PE=2 SV=1
6	Q9TU27	4.85e-114	326	221	0.799	0.792	IL12A_SHEEP Interleukin-12 subunit alpha OS=Ovis aries OX=9940 GN=IL12A PE=1 SV=1
7	W5NVX4	7.44e-114	326	221	0.799	0.792	W5NVX4_SHEEP Interleukin-12 subunit alpha OS=Ovis aries OX=9940 GN=IL12A PE=3 SV=1
8	P43431	4.34e-82	245	215	0.589	0.600	IL12A_MOUSE Interleukin-12 subunit alpha OS=Mus musculus OX=10090 GN=Il12a PE=1 SV=1
9	Q9R103	7.94e-81	242	215	0.589	0.600	IL12A_RAT Interleukin-12 subunit alpha OS=Rattus norvegicus OX=10116 GN=Il12a PE=2 SV=1
10	X1WG47	1.36e-06	49.3	196	0.237	0.265	X1WG47_DANRE Interleukin 12a OS=Danio rerio OX=7955 GN=IL-12 p35 PE=4 SV=1
11	O24573	2.9	31.2	319	0.091	0.063	RLA0_MAIZE Large ribosomal subunit protein uL10 OS=Zea mays OX=4577 GN=RP-P0 PE=1 SV=3
12	Q5VYK3	6.0	30.4	1845	0.128	0.015	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
13	J3KN16	8.0	30.0	2017	0.096	0.010	J3KN16_HUMAN Ecm29 proteasome adaptor and scaffold OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=1
14	R4GMY1	8.5	30.0	890	0.078	0.019	R4GMY1_HUMAN Ecm29 proteasome adaptor and scaffold (Fragment) OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=1
15	Q8ILP6	8.8	30.0	889	0.059	0.015	Q8ILP6_PLAF7 glycine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1420400 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03039 IL12	2.2e-118	404.7	Interleukin-12 alpha subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303231

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231228	0.998	Interleukin-12 subunit beta
2	9606.ENSP00000221847	0.987	Interleukin-27 subunit beta
3	9606.ENSP00000470788	0.967	Interleukin-12 receptor subunit beta-1
4	9606.ENSP00000412237	0.954	Interleukin-10
5	9606.ENSP00000385675	0.950	Interleukin-6
6	9606.ENSP00000231449	0.947	Interleukin-4
7	9606.ENSP00000262345	0.946	Interleukin-12 receptor subunit beta-2
8	9606.ENSP00000263341	0.941	Interleukin-1 beta
9	9606.ENSP00000306512	0.939	Interleukin-8
10	9606.ENSP00000296871	0.932	Granulocyte-macrophage colony-stimulating factor
11	9606.ENSP00000280357	0.930	Interleukin-18
12	9606.ENSP00000304915	0.930	Interleukin-13
13	9606.ENSP00000354394	0.930	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000327251	0.926	Nitric oxide synthase, inducible
15	9606.ENSP00000305651	0.922	C-X-C motif chemokine 10
16	9606.ENSP00000371067	0.922	Tyrosine-protein kinase JAK2
17	9606.ENSP00000264657	0.921	Signal transducer and activator of transcription 3
18	9606.ENSP00000376134	0.920	Signal transducer and activator of transcription 4
19	9606.ENSP00000474412	0.917	C-C motif chemokine 5
20	9606.ENSP00000431885	0.915	Non-receptor tyrosine-protein kinase TYK2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	0.997	protein heterodimerization activity
GO:0042163	0.997	interleukin-12 beta subunit binding
GO:0005102	0.969	signaling receptor binding
GO:0005125	0.760	cytokine activity
GO:0005126	0.433	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0032946	0.987	positive regulation of mononuclear cell proliferation
GO:0050896	0.685	response to stimulus
GO:0009987	0.653	cellular process
GO:0019222	0.566	regulation of metabolic process
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0009893	0.490	positive regulation of metabolic process
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0051239	0.435	regulation of multicellular organismal process
GO:0032501	0.392	multicellular organismal process
GO:0002694	0.389	regulation of leukocyte activation
GO:0051240	0.388	positive regulation of multicellular organismal process
GO:0051716	0.384	cellular response to stimulus
GO:0051249	0.379	regulation of lymphocyte activation
GO:0010468	0.369	regulation of gene expression
GO:0007165	0.363	signal transduction
GO:0002696	0.358	positive regulation of leukocyte activation
GO:0001819	0.315	positive regulation of cytokine production
GO:0002376	0.312	immune system process
GO:0048583	0.306	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005615	1.000	extracellular space
GO:0043514	0.592	interleukin-12 complex
GO:0005622	0.402	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]