StarFunc result for job id P29460

User Input

>input (328 residues)
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29460	1.000	1.000	1.206E-65	328	1.000	1.000	P29460.pdb.gz	IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens OX=9606 GN=IL12B PE=1 SV=1
2	PDB:5mj3A	0.913	0.991	9.375E-56	302	0.918	0.997	5mj3A.pdb.gz
3	AFDB:P46282	0.936	0.939	9.678E-55	327	0.817	0.820	P46282.pdb.gz	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1
4	AFDB:E9PU71	0.909	0.891	3.868E-46	335	0.655	0.642	E9PU71.pdb.gz	E9PU71_RAT Interleukin-12 subunit beta OS=Rattus norvegicus OX=10116 GN=Il12b PE=3 SV=2
5	AFDB:Q6X0K9	0.821	0.853	1.264E-34	315	0.436	0.454	Q6X0K9.pdb.gz	Q6X0K9_CHICK Interleukin-12 subunit beta OS=Gallus gallus OX=9031 GN=IL-12B PE=2 SV=1
6	AFDB:Q14626	0.531	0.432	1.403E-17	422	0.195	0.152	Q14626.pdb.gz	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
7	AFDB:A4JYQ0	0.480	0.444	6.014E-17	357	0.207	0.190	A4JYQ0.pdb.gz	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
8	AFDB:O88507	0.483	0.429	9.116E-17	372	0.223	0.196	O88507.pdb.gz	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
9	AFDB:Q64385	0.508	0.406	1.122E-16	432	0.195	0.148	Q64385.pdb.gz	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
10	AFDB:P08887	0.445	0.338	3.174E-16	468	0.183	0.128	P08887.pdb.gz	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
11	AFDB:P22272	0.461	0.356	3.174E-16	460	0.207	0.148	P22272.pdb.gz	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
12	PDB:7u7nC	0.455	0.721	1.560E-10	200	0.146	0.240	7u7nC.pdb.gz
13	PDB:7z0lB	0.420	0.377	2.583E-9	370	0.122	0.108	7z0lB.pdb.gz
14	PDB:8dtlA	0.224	0.112	9.052E-6	741	0.131	0.058	8dtlA.pdb.gz
15	PDB:1e07A	0.250	0.162	1.874E-5	642	0.113	0.058	1e07A.pdb.gz
16	PDB:6pxvA	0.234	0.105	4.306E-5	823	0.125	0.050	6pxvA.pdb.gz
17	PDB:8eyyA	0.236	0.112	6.526E-5	775	0.116	0.049	8eyyA.pdb.gz
18	PDB:5oj2B	0.255	0.157	1.423E-4	692	0.113	0.053	5oj2B.pdb.gz
19	PDB:1ct8A	0.218	0.314	2.157E-4	214	0.113	0.173	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
20	PDB:4xmpL	0.230	0.310	2.157E-4	211	0.101	0.156	4xmpL.pdb.gz	Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29460	0.0	678	328	1.000	1.000	IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens OX=9606 GN=IL12B PE=1 SV=1
2	P46282	0.0	569	327	0.845	0.847	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1
3	P68220	0.0	573	327	0.851	0.853	IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries OX=9940 GN=IL12B PE=1 SV=1
4	W5PUF3	0.0	548	324	0.832	0.843	W5PUF3_SHEEP Interleukin-12 subunit beta OS=Ovis aries OX=9940 GN=IL12B PE=3 SV=1
5	E9PU71	1.68e-155	440	335	0.680	0.666	E9PU71_RAT Interleukin-12 subunit beta OS=Rattus norvegicus OX=10116 GN=Il12b PE=3 SV=2
6	Q9R278	1.33e-154	438	335	0.677	0.663	Q9R278_RAT Interleukin-12 subunit beta OS=Rattus norvegicus OX=10116 GN=Il12b PE=2 SV=1
7	P43432	1.25e-153	436	335	0.680	0.666	IL12B_MOUSE Interleukin-12 subunit beta OS=Mus musculus OX=10090 GN=Il12b PE=1 SV=1
8	Q62712	2.96e-139	397	268	0.591	0.724	Q62712_RAT Interleukin-12 subunit beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Il12b PE=2 SV=1
9	Q6X0K9	2.83e-77	241	315	0.427	0.444	Q6X0K9_CHICK Interleukin-12 subunit beta OS=Gallus gallus OX=9031 GN=IL-12B PE=2 SV=1
10	O88507	1.33e-11	67.0	372	0.220	0.194	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
11	P26992	1.38e-11	67.0	372	0.223	0.196	CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
12	Q08406	2.30e-11	66.2	372	0.216	0.191	CNTFR_RAT Ciliary neurotrophic factor receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
13	P08887	1.82e-09	60.8	468	0.213	0.150	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
14	P22272	1.60e-08	57.8	460	0.223	0.159	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
15	A4JYQ0	2.01e-07	54.3	357	0.213	0.196	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
16	Q14213	2.20e-07	53.1	229	0.110	0.157	IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens OX=9606 GN=EBI3 PE=1 SV=2
17	Q14626	1.11e-06	52.0	422	0.195	0.152	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
18	Q99MF4	2.94e-06	50.8	431	0.195	0.148	I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
19	Q64385	9.65e-06	49.3	432	0.195	0.148	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
20	P22273	1.41e-05	48.9	462	0.192	0.136	IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il6r PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.43	22.3	Fibronectin type III domain
2	PF07679 I-set	1.2e+02	14.2	Immunoglobulin I-set domain
3	PF13895 Ig_2	0.15	23.7	Immunoglobulin domain
4	PF13927 Ig_3	0.011	27.5	Immunoglobulin domain
5	PF16680 Ig_4	0.65	22.0	T-cell surface glycoprotein CD3 delta chain
6	PF16681 Ig_5	0.036	25.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF10420 IL12p40_C	1.8e-21	87.8	Cytokine interleukin-12p40 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228534	0.998	Interleukin-23 subunit alpha
2	9606.ENSP00000303231	0.998	Interleukin-12 subunit alpha
3	9606.ENSP00000321345	0.989	Interleukin-23 receptor
4	9606.ENSP00000470788	0.976	Interleukin-12 receptor subunit beta-1
5	9606.ENSP00000412237	0.963	Interleukin-10
6	9606.ENSP00000385675	0.960	Interleukin-6
7	9606.ENSP00000262345	0.957	Interleukin-12 receptor subunit beta-2
8	9606.ENSP00000263341	0.946	Interleukin-1 beta
9	9606.ENSP00000296871	0.942	Granulocyte-macrophage colony-stimulating factor
10	9606.ENSP00000306512	0.940	Interleukin-8
11	9606.ENSP00000280357	0.939	Interleukin-18
12	9606.ENSP00000231449	0.937	Interleukin-4
13	9606.ENSP00000304915	0.936	Interleukin-13
14	9606.ENSP00000225474	0.934	Granulocyte colony-stimulating factor
15	9606.ENSP00000431885	0.932	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000327251	0.931	Nitric oxide synthase, inducible
17	9606.ENSP00000379110	0.931	Growth-regulated alpha protein
18	9606.ENSP00000225831	0.928	C-C motif chemokine 2
19	9606.ENSP00000427279	0.928	C-X-C motif chemokine 2
20	9606.ENSP00000474412	0.927	C-C motif chemokine 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	0.997	cytokine binding
GO:0046982	0.996	protein heterodimerization activity
GO:0005126	0.996	cytokine receptor binding
GO:0070851	0.994	growth factor receptor binding
GO:0042164	0.967	interleukin-12 alpha subunit binding
GO:0005125	0.942	cytokine activity
GO:0042802	0.690	identical protein binding
GO:0005143	0.541	interleukin-12 receptor binding
GO:0008083	0.451	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0042127	0.987	regulation of cell population proliferation
GO:0048522	0.986	positive regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0070663	0.975	regulation of leukocyte proliferation
GO:0032946	0.946	positive regulation of mononuclear cell proliferation
GO:0048583	0.944	regulation of response to stimulus
GO:0006955	0.927	immune response
GO:0022409	0.915	positive regulation of cell-cell adhesion
GO:0001819	0.913	positive regulation of cytokine production
GO:1903039	0.908	positive regulation of leukocyte cell-cell adhesion
GO:0002696	0.903	positive regulation of leukocyte activation
GO:0071704	0.901	organic substance metabolic process
GO:0051249	0.891	regulation of lymphocyte activation
GO:0001775	0.886	cell activation
GO:0050870	0.877	positive regulation of T cell activation
GO:0032729	0.869	positive regulation of type II interferon production
GO:0042102	0.866	positive regulation of T cell proliferation
GO:0045321	0.865	leukocyte activation
GO:0043170	0.861	macromolecule metabolic process
GO:0051716	0.842	cellular response to stimulus
GO:0048584	0.842	positive regulation of response to stimulus
GO:0046006	0.822	regulation of activated T cell proliferation
GO:0010646	0.776	regulation of cell communication
GO:0023051	0.771	regulation of signaling
GO:0007154	0.746	cell communication
GO:0023052	0.745	signaling
GO:0046649	0.738	lymphocyte activation
GO:0007165	0.732	signal transduction
GO:0050776	0.731	regulation of immune response
GO:0009966	0.729	regulation of signal transduction
GO:0031323	0.727	regulation of cellular metabolic process
GO:0048519	0.701	negative regulation of biological process
GO:0042221	0.684	response to chemical
GO:0006950	0.680	response to stress
GO:0010467	0.669	gene expression
GO:0050778	0.664	positive regulation of immune response
GO:0023056	0.631	positive regulation of signaling
GO:0010647	0.631	positive regulation of cell communication
GO:0002252	0.627	immune effector process
GO:0032101	0.621	regulation of response to external stimulus
GO:0080090	0.613	regulation of primary metabolic process
GO:0080134	0.602	regulation of response to stress
GO:0051171	0.594	regulation of nitrogen compound metabolic process
GO:0031347	0.591	regulation of defense response
GO:0032502	0.587	developmental process
GO:0032103	0.561	positive regulation of response to external stimulus
GO:0009967	0.551	positive regulation of signal transduction
GO:0048856	0.545	anatomical structure development
GO:0010033	0.527	response to organic substance
GO:0070887	0.514	cellular response to chemical stimulus
GO:0031325	0.514	positive regulation of cellular metabolic process
GO:0051173	0.507	positive regulation of nitrogen compound metabolic process
GO:0048523	0.502	negative regulation of cellular process
GO:0051246	0.491	regulation of protein metabolic process
GO:0071310	0.454	cellular response to organic substance
GO:0071345	0.436	cellular response to cytokine stimulus
GO:0050793	0.428	regulation of developmental process
GO:0007166	0.406	cell surface receptor signaling pathway
GO:0042327	0.405	positive regulation of phosphorylation
GO:0051247	0.404	positive regulation of protein metabolic process
GO:0031399	0.396	regulation of protein modification process
GO:0009607	0.395	response to biotic stimulus
GO:0046634	0.391	regulation of alpha-beta T cell activation
GO:0044419	0.386	biological process involved in interspecies interaction between organisms
GO:0010941	0.384	regulation of cell death
GO:0009605	0.378	response to external stimulus
GO:0050727	0.368	regulation of inflammatory response
GO:0031401	0.367	positive regulation of protein modification process
GO:0001932	0.355	regulation of protein phosphorylation
GO:0051707	0.351	response to other organism
GO:0006952	0.347	defense response
GO:0002697	0.338	regulation of immune effector process
GO:0051094	0.334	positive regulation of developmental process
GO:0009892	0.333	negative regulation of metabolic process
GO:0065009	0.332	regulation of molecular function
GO:0002819	0.325	regulation of adaptive immune response
GO:0002699	0.320	positive regulation of immune effector process
GO:0045595	0.319	regulation of cell differentiation
GO:0002824	0.319	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0044093	0.307	positive regulation of molecular function
GO:0031349	0.307	positive regulation of defense response
GO:0009889	0.303	regulation of biosynthetic process
GO:0043067	0.300	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0032991	0.997	protein-containing complex
GO:0005622	0.689	intracellular anatomical structure
GO:0070013	0.530	intracellular organelle lumen
GO:0071944	0.465	cell periphery
GO:0005737	0.461	cytoplasm
GO:0005886	0.437	plasma membrane
GO:0043227	0.407	membrane-bounded organelle
GO:0012505	0.359	endomembrane system
GO:0031981	0.338	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]